KEGG   Salinispora tropica: Strop_2221
Entry
Strop_2221        CDS       T00504                                 

Definition
(GenBank) DegT/DnrJ/EryC1/StrS aminotransferase
  KO
K13308  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
stp  Salinispora tropica
Pathway
stp00523  Polyketide sugar unit biosynthesis
stp01100  Metabolic pathways
stp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Strop_2221
Enzymes [BR:stp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     Strop_2221
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_5
Other DBs
NCBI-ProteinID: ABP54672
UniProt: A4X722
LinkDB
Position
complement(2513431..2514642)
AA seq 403 aa
MKNTVADLAVLGGTPTFPQVLQVGTPSVGERSRLFERLNTALDNRWLTNGALVREFEERI
AELAGVRHCVATCSGTMALQLLYQATGLTGEIIMPAMTYVATAHAASMLGLTPVFADIDP
ETGCLDPQQVETVLTPRTSGIVGVHLWGRPCAADELEKVAKEHGLTLVFDAAHALGCSHQ
GRRIGGFGSAEMFSFHATKVVNCFEGGAVATDDDALAGELRVLRTFGITTDGRSLGVGTN
AKMTEASAAMGLTSLDAFTETMRHNRANHARYCSALRGCSGLTVVDFDEAQDPNWQYVIV
KIDEAVTGIHRDLVMRILRAENTGAQRYFSPACHQLEPYRSQRPVPLPHTERLAEQVLAL
PTGPAVSAVDIDRICSIVRCAVSHGPELADRLGPSPTRPFAIS
NT seq 1212 nt   +upstreamnt  +downstreamnt
gtgaaaaacacggtcgctgatctcgccgtcctcggcgggactccgacgttcccgcaggtg
ctccaggtgggaacgcccagcgtgggagagcggtcgcggttgttcgagcggctgaacacc
gcactggacaacaggtggctcaccaacggagcgctggtcagggagttcgaggaacgcatc
gccgagctggcgggcgtgcggcactgcgtggcgacctgcagcggcaccatggcgctgcaa
ctgctctaccaggctaccgggctcaccggcgagatcatcatgcctgcgatgacctacgtg
gccaccgcgcatgccgcctcgatgctggggctgacgccggtcttcgccgacatcgatccg
gagaccggatgtctcgacccgcagcaggtggagacggtgctgacaccgcgcacctcgggc
atcgtcggcgtacacctctggggccggccctgcgcggcggacgagctggaaaaggtggcc
aaggagcacggcctgacacttgtcttcgatgcggcgcacgcactggggtgcagtcatcag
ggccgccggatcggtggcttcggtagtgcggagatgttcagcttccatgccaccaaggtc
gtcaactgcttcgagggcggggccgtggcgaccgacgacgatgctctcgccggggaactt
cgggtgctgcgtaccttcgggatcaccaccgacggccgtagcctgggtgtcggcaccaac
gccaagatgaccgaggcctccgcggcgatgggactgacctcgctggacgccttcactgag
accatgcgccacaatcgtgccaaccacgcacgctactgttctgcgttacgcgggtgcagt
ggcctcaccgtcgtcgatttcgacgaggcccaggatcccaactggcagtacgtcatcgtc
aagatcgacgaagcggtcaccggcatccaccgcgacctggtgatgcgaatactccgggca
gagaatacgggcgcgcagcgctacttctctccggcctgtcaccagctggagccctaccgc
tcccaacgtccggtccccctgccgcacaccgagcgcctggcggaacaggttctcgccctg
ccgaccggccctgcggtctccgcggtggacatcgaccgaatctgcagcatcgtgcggtgc
gcagtctcccacggaccagagctcgccgaccggctcggcccgagccccacccgcccattc
gccatctcctag

DBGET integrated database retrieval system