KEGG   Salinispora tropica: Strop_3793Help
Entry
Strop_3793        CDS       T00504                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
stp  Salinispora tropica
Pathway
stp00020  Citrate cycle (TCA cycle)
stp00480  Glutathione metabolism
stp01100  Metabolic pathways
stp01110  Biosynthesis of secondary metabolites
stp01120  Microbial metabolism in diverse environments
stp01130  Biosynthesis of antibiotics
stp01200  Carbon metabolism
stp01210  2-Oxocarboxylic acid metabolism
stp01230  Biosynthesis of amino acids
Module
stp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
stp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:stp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Strop_3793
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Strop_3793
Enzymes [BR:stp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Strop_3793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABP56224
UniProt: A4XBC5
LinkDB All DBs
Position
complement(4346984..4348198)
Genome map
AA seq 404 aa AA seqDB search
MAKIKVNNPVVELDGDEMTRIIWKQIREQLILPYLDVDLRYYDLSIQHRDETDDQATVDA
ANAIKEHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIMSNVPRL
VPGWTKPIIIGRHAHGDQYKASDFVVPGPGKVTITYTPTDGTQPVEMEIADFPGGGVAMG
MYNFDESIRDFARASMRYGLDRGYPVYLSTKNTILKAYDGRFKDIFAEVYEAEFKADFEA
AGISYEHRLIDDMVAAALKWEGGFVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGR
TVEAEAAHGTVTRHYRQYQKGEKTSTNPIASIYAWTRGLAHRGKLDGTPAVTEFANTLEK
VIIETVEGGQMTKDLALLISRDAPWLTTDEFMNALDENLARKLA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtaaacaacccggtcgtagagctcgacggcgacgagatgacccgg
atcatctggaagcagatccgggagcagctgatcctgccctacctcgacgtcgacctgcgg
tactacgatctctcgatccagcaccgggacgagacggacgaccaggccaccgttgacgcc
gccaacgcgatcaaggagcacggcgtcggcgtcaagtgcgccacgatcacgccggacgag
gcgcgggtcgaggagttcggcctgaagaagatgtggcggtcgccgaacggcaccatccgc
aacatcctcggtggcgtcgtcttccgtgagccgatcatcatgtccaacgtgccgcggctg
gtgcccggttggacgaagccgatcatcatcggccggcacgcccacggtgaccagtacaag
gccagcgacttcgtcgtccccgggcccggcaaggtcaccatcacctacaccccgaccgac
ggcacccagccggtcgagatggagatcgccgacttccccggcggcggggtcgccatgggc
atgtacaacttcgacgagtcgatccgggactttgcccgtgcctccatgcggtacggcctc
gaccgtggctacccggtctacctgtcgaccaagaacaccatcctcaaggcgtacgacggc
cggttcaaggacatcttcgccgaggtctacgaggccgagttcaaggccgacttcgaggct
gccggcatcagctacgagcaccggctgatcgacgacatggtcgccgcggcgctcaagtgg
gagggcggcttcgtctgggcctgcaagaactacgacggtgacgtgcagtccgacaccgtc
gcgcagggcttcggctcgctcggcctgatgacgtccgtgctgatgaccccggacggccgc
actgtcgaggccgaggcggcgcacggtaccgtcacccggcactaccggcagtaccagaag
ggcgagaagacctcgaccaacccgatcgcctcgatctacgcctggacccggggcctggcc
caccggggcaagctggacggcaccccggcggttaccgagttcgccaacaccctggaaaag
gtcatcatcgagaccgtcgagggcggccagatgaccaaggacctcgcgctactgatctcg
cgggacgccccgtggctgaccaccgacgagttcatgaacgcgctggacgagaacctggcc
cgtaagctcgcctga

DBGET integrated database retrieval system