KEGG   Spirochaeta thermophila DSM 6578: Spith_0613Help
Entry
Spith_0613        CDS       T02016                                 

Definition
(GenBank) D-alanine--D-alanine ligase domain protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
stq00473  D-Alanine metabolism
stq00550  Peptidoglycan biosynthesis
stq01100  Metabolic pathways
stq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Spith_0613
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Spith_0613
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Spith_0613
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:stq01011]
    Spith_0613
Enzymes [BR:stq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Spith_0613
Peptidoglycan biosynthesis and degradation proteins [BR:stq01011]
 Precursor biosynthesis
  Amino acid ligase
   Spith_0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Methyltransf_25 Methyltransf_11 Methyltransf_31 Ubie_methyltran Methyltransf_23 Methyltransf_12 MTS ATPgrasp_Ter TehB ATP-grasp_4 ATP-grasp_3 Cons_hypoth95 Methyltransf_29 MetW
Motif
Other DBs
NCBI-ProteinID: AEJ60893
UniProt: G0GA57
LinkDB All DBs
Position
713385..715331
Genome map
AA seq 648 aa AA seqDB search
MIEEKTQETDKPPERRRRRIPAARARCLGPLSDLESHVAPDWWSRIFNSYYMKTDGDVVD
DLAITRKEDDLFTSVLGLKKEEVVLDLCCGQGRHSLELARRGFTRVEGLDRSHYLIQRAK
AQAAKEGLPVKFREGDARKLPYPPDQFDVVMILGNSFGYFESSKDDLLVLKEVARVLKPW
GRILLDLADGEYLRAHYVPRSWEWIDAKHFVCRERALSADRQRLISREVIVHTEKGVEVD
QFYAERLYTPELIRSLLEEAGFQEVSFHGSLTPDSARGQDLGMMERRILVSARIRKEWAP
VKSRKKNVSTQVAVVMGDPSKPDPLKPFMVFDDDDLYTIDRLKAALKECTGYSFTYLSRH
ETLIQDLMRLKGKVDYVFNLCDEGFFNDPRKELHVPALLEMLGIPYTGATPQGLAFCYDK
SLVRGVAKEMGVPVPRAFFIDPTSIVFEVPFGFPMIVKPNLGDSSFGITQKSVVWSLDEL
SACISEIRDTFGYEKPVLVEEFLTGKDLTVGIIGNPTDDYMVLPIVEEDYSALPPELPRI
CGYEAKWLPDSPYWKALRSIPAGLPEETEKSIVEWCVRLFERLECRDYARFDWRCDADGN
PYLLEVNPNPGWCWDGHLAKMARLAGMEYPRMLEAILKAAEKRLGIRS
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagagaagacccaggagacagacaagcctccggaacggaggcgaagacggatc
cctgccgcacgggcccggtgtcttggtccgctttccgatctggaatcccacgtggccccg
gactggtggtccaggatcttcaactcctactacatgaagaccgacggcgatgtggtggac
gatcttgccatcacgcggaaggaggatgatctctttacttctgtccttggtctcaagaaa
gaggaggtggtgcttgacctgtgctgtggtcaggggaggcactccctcgagctcgcacgc
aggggtttcaccagggtggaaggactcgacaggtcccactacctcatccagagggcgaag
gcccaggcggcgaaagaagggctgccggtgaagttcagagaaggggacgcacgaaaactg
ccctatcccccggatcagttcgacgtggtgatgatcctgggcaacagcttcggctacttc
gagagcagcaaggacgatcttcttgtcctaaaggaggtggcgcgtgtcctcaaaccgtgg
ggacggatactcctcgatctggccgatggtgagtatctacgagcacactacgttccccgc
tcatgggagtggatcgatgcaaagcactttgtctgcagggagcgggccctctcggctgat
cggcagaggctcatctcacgggaggtgatcgtccataccgagaagggggtggaggtggat
cagttctatgccgagaggctctacacacccgagctcatacgatctctcctcgaggaggcg
ggcttccaggaggtgtccttccacgggagtctcacccccgactcggcacggggacaggac
ctcgggatgatggagcggcgcatcctggtgagtgcgaggatacggaaggagtgggcacct
gtaaaatcgagaaagaagaatgtgtccactcaggtggcggtggtgatgggcgacccctcg
aagcccgatccgctcaagccgttcatggtgttcgacgacgatgatctctacaccatcgat
cggctcaaggctgcgctcaaagagtgtacaggctattccttcacctatctttcgcgccac
gagactctcatacaggatcttatgaggctcaaggggaaggtcgattacgtgttcaatctg
tgtgacgagggatttttcaacgatccgaggaaggagctgcacgtgccggcgctcctcgag
atgctcggcatcccctataccggcgcgacacctcaggggctcgccttctgctacgacaag
tcgctcgtacggggggtggcgaaggagatgggagtgcccgtgcctcgtgccttcttcata
gatcccacgtcgatcgtcttcgaggtaccgttcggttttcccatgatcgtcaagccgaac
ctcggagattccagtttcgggatcacgcagaagagcgtggtgtggtcgctcgatgagctt
tccgcctgcatctccgagatcagggatacgttcggctacgaaaagccggtgcttgtggag
gaattcctcacggggaaggatctgacggtggggatcatcgggaatccgacggacgactac
atggtgctccccatagtggaagaggactactcagcgctcccgccggagcttcctcggatc
tgcggatacgaggcgaaatggctccccgactctccctactggaaggccctccggtcgatt
cccgcagggcttcccgaggagacggagaagtccatcgtggagtggtgtgtccgtcttttc
gagcggctggagtgtcgggactacgcccggttcgactggagatgcgacgcggatgggaat
ccgtatcttctggaggtgaaccccaaccccggttggtgttgggacgggcacctcgcaaag
atggcacgcctcgcgggtatggagtatccccggatgctggaggccatcctgaaggcggcc
gagaagcgattggggatacggtcgtag

DBGET integrated database retrieval system