KEGG   Spirochaeta thermophila DSM 6578: Spith_0616Help
Entry
Spith_0616        CDS       T02016                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
stq00040  Pentose and glucuronate interconversions
stq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spith_0616
Enzymes [BR:stq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     Spith_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 3HCDH_N Glu_dehyd_C NADH_4Fe-4S Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AEJ60896
UniProt: G0GA60
LinkDB All DBs
Position
complement(717204..718241)
Genome map
AA seq 345 aa AA seqDB search
MTSYMSAVVITSPHQAKIEKRPIPTPGPHELLIRVHRAGICGSDMHIYEGSNPFVSYPRI
PGHELAGEVVSWGSEVTTAPPPGTRVVVDPVISCGKCIACRTGHPNVCRNLQVVGVHRDG
GFAPYLTVPATNVHPIPDGLTWEEAVFIEPYSIAANVRHRLQVTPDDIVLIIGAGIIGTL
SLQVMRLTGARTIICDISESALERARRMGADETLNTAGKDLAGEVLARTDGEGATAVVDA
VGAPSLFESIVRCSAPGARIVLLGFSSTPTPIPQAEIIRKELSILGSRLNNRKFPEIVSL
LAEGKLNPSPLLAGVHPLDEAPSLLERAAEEHTLPGKVLLTCEEE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgtatatgagtgcagtggtgatcacctccccccatcaggccaagatagaaaaa
cgacccatacccacccccggcccccacgagctgctcatcagggtacaccgtgccgggatc
tgcggatcggacatgcacatctacgagggctcgaaccccttcgtctcctacccccgcata
ccgggacacgaactcgcaggcgaagtcgtctcctgggggagcgaggtgacgaccgcccct
cccccgggcacgcgggtggtggtggacccggtgataagctgcgggaagtgcatcgcgtgc
aggacgggccaccccaatgtgtgccgcaacctccaggtcgtgggagttcaccgggacgga
ggcttcgccccctacctcaccgtgccggcgacgaacgtccaccccataccggacggtctc
acatgggaagaagcggtcttcatcgaaccctactccatcgcggcgaacgtgcgacacagg
ctccaggtgaccccagacgatatcgtactcatcataggagcgggaatcataggaaccctc
tcccttcaagtcatgcgcctcacaggggcgagaaccatcatctgcgacatctctgaatca
gccctcgagagggcgcgacgcatgggtgccgacgagacgctcaacaccgcaggaaaagac
ctcgccggcgaggtcctcgcccgcacagacggggaaggagccacggccgtggtggacgcc
gtgggagcgccctcgctcttcgagtccatcgtcaggtgcagtgcgccgggagcccgtatc
gtcctcctgggcttctccagcacccccacccccatcccccaggcagagatcatccgcaag
gaactctccatcctggggagcaggctcaacaaccggaagtttccggaaatagtctccttg
ctcgccgaagggaagctgaatccctccccacttctcgccggggtccaccccctcgacgaa
gccccctccctcctcgaacgtgccgcggaggaacacacactcccggggaaggtccttctc
acctgtgaggaggagtga

DBGET integrated database retrieval system