KEGG   Sebaldella termitidis: Sterm_0272Help
Entry
Sterm_0272        CDS       T01123                                 

Definition
(GenBank) Xylose isomerase domain protein TIM barrel
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
str  Sebaldella termitidis
Pathway
str00040  Pentose and glucuronate interconversions
str00051  Fructose and mannose metabolism
str01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:str00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sterm_0272
   00051 Fructose and mannose metabolism
    Sterm_0272
Enzymes [BR:str01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Sterm_0272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 DUF659
Motif
Other DBs
NCBI-ProteinID: ACZ07157
UniProt: D1AKZ1
LinkDB All DBs
Position
296803..297729
Genome map
AA seq 308 aa AA seqDB search
MKFAARINSFKSKGKTTLDIIREISKIEKVTHVDLNYPEHFENTDFEELKNLLEEKKIKV
NGLALRFRDEYKNGELGNTDKKIAEQAKQLCLEAIDTAEKLGADLVTIWLGYDGFDYSFQ
IPYEKTWSQLVKAFKEIASYNKKIKISIEYKPFQPRAFSMISSIGTTLLMVSETEEENIG
VTLDYCHMLMKGENPAYGLSLAAERKKLYGVHMNDGHGLNDDGLITGSVTFIKTLEFIYY
LKKYSYDGVIYFDTFPIRENGIDEVRKNIEIYEKLESLVEKIGIEKIGNIVSGNDAVKAQ
NILLECLG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcagcaagaattaacagttttaaaagtaaaggaaaaactacactggacatt
ataagagaaatttcaaaaatagaaaaggtaacacatgtagatttaaattatcctgaacat
tttgaaaatacagattttgaagaattaaaaaatcttttggaggagaaaaaaataaaggta
aacggtctggctttgagattcagagatgaatataaaaacggagagctgggaaatacagat
aaaaaaatagcagaacaggcaaaacaattatgcctggaagctatagacacagctgaaaaa
ttgggggctgatctggttacgatctggctgggatacgatggatttgactattcatttcag
attccgtatgaaaagacatggagccagctggtaaaagcattcaaggaaatagcctcttat
aacaaaaaaataaaaataagcatagaatataagccgtttcagccgagagcattttcaatg
atttcaagtataggaacaacattactgatggttagtgaaacagaagaagaaaatattggt
gtgacgctggattactgtcatatgctgatgaagggcgaaaatccggcatacggactgtca
ctggcagctgaaagaaaaaaactgtacggcgtacatatgaatgacggccacggactgaat
gatgacggcttaataacaggaagcgtgacttttataaaaactttagaatttatatattat
ctgaaaaaatattcttatgacggagttatatattttgacacatttcctataagagaaaat
ggtatagatgaagtgagaaaaaatatagaaatatatgaaaaattggaaagtttagtagaa
aaaataggtatagagaaaattggaaatatagtaagcggaaatgatgcggtgaaggcacag
aatattctgttagaatgtctgggataa

DBGET integrated database retrieval system