KEGG   Sebaldella termitidis: Sterm_0601Help
Entry
Sterm_0601        CDS       T01123                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
str  Sebaldella termitidis
Pathway
str00010  Glycolysis / Gluconeogenesis
str00260  Glycine, serine and threonine metabolism
str00680  Methane metabolism
str01100  Metabolic pathways
str01110  Biosynthesis of secondary metabolites
str01120  Microbial metabolism in diverse environments
str01130  Biosynthesis of antibiotics
str01200  Carbon metabolism
str01230  Biosynthesis of amino acids
Module
str_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
str_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:str00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sterm_0601
  09102 Energy metabolism
   00680 Methane metabolism
    Sterm_0601
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sterm_0601
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:str04131]
    Sterm_0601
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:str04147]
    Sterm_0601
Enzymes [BR:str01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sterm_0601
Membrane trafficking [BR:str04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Sterm_0601
Exosome [BR:str04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sterm_0601
  Exosomal proteins of melanoma cells
   Sterm_0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C Sugar-bind
Motif
Other DBs
NCBI-ProteinID: ACZ07474
UniProt: D1AP00
LinkDB All DBs
Position
complement(651971..652660)
Genome map
AA seq 229 aa AA seqDB search
MYLVFIRHGQSEWNKKNLFTGWTDVDLSDEGINEAIKAGQLLKKHNFTFDVAYTSVLKRA
IRTLYFVLNETDQLWIPVYKSWRLNERHYGALQGLNKAQTAEKYGDEQVHIWRRSYDVLP
PLLDENDERQSKFDRRYEGLDSRILPSGENLKVTLERVMPYWEDEIAPALKSGKKVVIAA
HGNSLRALAKYLENISDDEIMDLEIPTGVPLIYELDDNFKVLKKYYLED
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtatttagtttttattcgtcatggtcaaagtgagtggaataaaaagaatcttttcaca
ggctggactgacgttgatttatccgatgaaggtataaatgaagctattaaagccggacag
ctgctaaaaaaacacaattttacttttgacgtggcttacacttctgttttaaaaagagca
attcgaacactttactttgttttaaatgaaactgaccagctgtggataccggtttataaa
tcatggcgtctgaatgaaagacactacggagctcttcaggggcttaataaggctcagaca
gcggaaaaatacggtgacgagcaggttcatatatggcgtcgaagttatgatgtactccct
ccgcttttagacgaaaatgatgaaagacagtcaaaatttgacaggagatatgaaggattg
gattcccgtattttaccttcaggagaaaatctgaaagtaacccttgaaagagtgatgcct
tactgggaagacgaaattgcccctgcactgaaatcaggaaaaaaagtagttattgcagcg
catggaaacagtcttcgtgccttggcaaagtatctcgagaatataagcgatgacgagatc
atggatttggaaatacctacaggtgttcctcttatttatgaacttgatgataattttaaa
gttttgaaaaaatattaccttgaagattaa

DBGET integrated database retrieval system