KEGG   Sebaldella termitidis: Sterm_3219Help
Entry
Sterm_3219        CDS       T01123                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
Organism
str  Sebaldella termitidis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NAD_binding_3 UDPG_MGDP_dh_N 2-Hacid_dh_C Sacchrp_dh_NADP Shikimate_DH TrkA_N ThiF ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ACZ10060
UniProt: D1APM6
LinkDB All DBs
Position
complement(3370449..3371492)
Genome map
AA seq 347 aa AA seqDB search
MENSKAILKVPGTMEIRPAEMPVLRDEDVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVGIGSKVKKFQIGDKVNIEPGVPCGKCRFCLEGKYNICPDVDFMATQPN
YKGALTKYLSHPESFTYKLPDNMDTMEGALVEPAAVGIHAALLAGVTPGKKIVILGAGCI
GLMTLQACKTMGAAEIVVVDVLKKRLEMAKKLGAMEVIDSSEADTVTECKRILGELGADI
VFETAGVQVTAKLTPQIVMRGGKIMIVGTIPGETPIDFLKINREVSIQTVFRYANCYPTT
IEAISSGKFDVKSMVTNIYGYEEVQKAFEESINNKKDIIKGVIKIAD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattcaaaagccattttaaaagtaccgggaacaatggaaattcgtccggcagaa
atgcctgttttaagggatgaggatgttttaatcaaggtggagtatgtcggtatttgcgga
tctgatgttcacgggtttgaatcaggaccttttattccgcctaaagatccgaatcaggaa
attggattagggcatgaatgtgcaggaactgtagtcggtattggaagtaaagtaaaaaaa
tttcaaattggggataaagtaaatattgaaccgggtgtcccgtgcggaaagtgcagattt
tgtctggaagggaagtacaatatctgtcctgacgtagattttatggcaacacagccgaat
tataaaggtgcattaacaaaatatctgtctcatcctgaaagctttacttataaattaccg
gataatatggatactatggaaggtgctctggtagaacctgctgctgttggaatacatgct
gctttacttgcaggcgtgacaccggggaaaaaaatagtcatattaggtgcgggatgtata
ggtcttatgacattacaggcatgtaaaactatgggagcagctgagatagtagtggtagat
gttctgaaaaaaagacttgaaatggcaaaaaagctgggtgcaatggaggtaatcgacagc
agtgaggctgatacagtaacagaatgcaaaagaatattgggagaattaggtgctgatatt
gtttttgaaactgcaggtgttcaggttactgcaaaattaactccgcagattgttatgcgt
ggcggaaaaatcatgatagtcggaactataccgggggagactcctattgattttcttaag
ataaatcgtgaggtttccattcagacagtattcagatatgcaaactgctatccgactact
atagaagcgatatcatcagggaagttcgatgtgaaatccatggtaacaaatatttatggt
tatgaagaagtacaaaaggcttttgaagaatcgataaacaataaaaaagatattattaaa
ggcgtaataaaaatagcagactag

DBGET integrated database retrieval system