KEGG   Sebaldella termitidis: Sterm_3691Help
Entry
Sterm_3691        CDS       T01123                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
str  Sebaldella termitidis
Brite
KEGG Orthology (KO) [BR:str00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sterm_3691
Enzymes [BR:str01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sterm_3691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 FAD_oxidored GIDA HI0933_like DAO Thi4 K_oxygenase NAD_binding_8 NAD_binding_7 FAD_binding_3 FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACZ10525
UniProt: D1ARN9
LinkDB All DBs
Position
complement(3918099..3919079)
Genome map
AA seq 326 aa AA seqDB search
MDFNLNLGCIDEGNLSEISCDKLYDVLVVGTGPSAVSAAIYAARKGLDVAMIGLKIGGQV
LDTREIENIIGTAKTTGSEYAENLEKHLKEYCVAFKEGTYVTKIEEDGKNKLITTSDKKI
YKSKTVIIATGAKWRELNVPGEQEYKGKGVHYCATCDGPFYKGLDVAVVGGGNSGIEAAL
DMAGIAKNVTVVEFMPELKADKILQDKLNERNNIKVITNAATTKIYGEDFTKGMEYKNRA
DESTHELNIDGVFIEIGLTPNSEFAKDLIATNKIGEIIIDENNMTNIKGIFASGDVTTVK
QKQIVISVGEGAKAALGAFDYLLKEY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggactttaatttaaatcttgggtgcatagatgagggaaacttatcagagatttcttgt
gataaattatatgatgtgcttgtagttggtacagggccgtcagcagtttcagctgcaata
tatgcagcaagaaaaggtcttgatgttgcaatgataggacttaaaataggcggacaggtt
ttggacacaagagagatagaaaatatcataggtacagctaaaactacagggtcagagtat
gccgagaatcttgaaaagcatttgaaagaatattgtgttgcctttaaagaagggacatat
gtgacaaaaatagaagaagacggaaaaaataaattaattactacaagtgataagaaaata
tataaatcaaaaactgtaataatagcaactggtgctaagtggagagaattaaatgttccc
ggagagcaggaatataaaggaaaaggagttcactactgtgctacttgtgacggaccgttt
tacaaaggactggatgtagctgtggtaggcggaggaaattccggaatagaagctgccctt
gatatggcagggatagccaaaaatgtaactgtagtggaattcatgcctgaactaaaagct
gataaaatattacaggataaactaaatgaaagaaataatatcaaagtcatcacaaatgct
gctactacaaaaatatacggggaagactttacaaaaggaatggaatataaaaacagagca
gatgaaagtacacatgaactgaatatcgacggtgtatttatagaaataggacttacacca
aacagcgaattcgcaaaggatctgatagcgactaacaaaatcggggaaatcataattgat
gaaaacaatatgactaacataaaaggaatctttgcttcaggtgatgtaacaacagtaaaa
caaaaacagatagtcatatctgtaggagaaggagcaaaagctgctttaggggcttttgat
tacctgctgaaagagtattaa

DBGET integrated database retrieval system