KEGG   Streptococcus sp. A12: ATM98_00820Help
Entry
ATM98_00820       CDS       T05522                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
stra  Streptococcus sp. A12
Pathway
stra00473  D-Alanine metabolism
stra00550  Peptidoglycan biosynthesis
stra01100  Metabolic pathways
stra01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ATM98_00820
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ATM98_00820
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ATM98_00820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:stra01011]
    ATM98_00820
Enzymes [BR:stra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ATM98_00820
Peptidoglycan biosynthesis and degradation proteins [BR:stra01011]
 Precursor biosynthesis
  Amino acid ligase
   ATM98_00820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 Ham1p_like
Motif
Other DBs
NCBI-ProteinID: AMP66326
UniProt: A0A127TQY5
LinkDB All DBs
Position
139836..140882
Genome map
AA seq 348 aa AA seqDB search
MAKEKIVLLYGGRSAEREVSVLSAESVMRAINYDKYSVETYFITQAGDFIKTQTYEEKPA
ETERLMTNETIDWEAKVSPCSIYQEGAVVFPVLHGPMGEDGSVQGFLEVLKLPYVGCDIL
SSSVAMDKITTKRVLESAGIPQVPYVAVLEGDDLEAKIALIETELTYPVFTKPSNMGSSV
GISKAENQAELRQSLELAFKYDSRVLVEQGVVAREIEVGLLGNYDVKSTLPGEVVKDVAF
YDYEAKYIDNKITMAIPAEIPAEVAATMRQNAELAFRAIGGRGLSRCDFFYTEDGGIYLN
ELNTMPGFTQWSMYPLLWDNMGLSYPDLIERLVELAKATFEKREAHLL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaaattgtacttctttatggtggccgtagcgcagagcgcgaagtgtct
gtactttcagctgaaagcgtcatgcgggcgattaattatgacaagtattctgttgagacc
tatttcattactcaggcgggagacttcatcaagacccaaacctatgaagagaagcctgct
gaaacagaacgcttgatgaccaacgagaccattgattgggaagctaaagtatctccgtgc
agtatctaccaagaaggagcggttgtctttccagtccttcacggaccaatgggagaagat
ggatcggttcaaggtttcctagaagtcttgaaacttccatatgtgggatgtgatatcctt
tcttctagtgtggcgatggacaagattaccaccaaacgggtcctagaatcagcagggatt
ccacaagttccttatgtagcagtccttgaaggagatgacctagaagctaaaattgcttta
atcgaaacagaattgacctatccggtctttactaagccttctaatatgggatctagtgtc
gggatttcaaaagcagagaaccaggcagaacttcgtcaatctttggaattggcctttaaa
tacgatagccgtgttctggttgagcaaggtgtcgtagcgcgtgaaatcgaagtgggattg
ttgggtaactatgatgtcaagagcaccctccctggtgaggtggtcaaagatgtggccttc
tacgactatgaagccaaatacatcgataataagattacgatggcgattccagctgaaatt
cctgcagaagttgctgcgaccatgcgtcagaatgcggaattggccttccgtgccattggt
gggagaggtctctcccgttgtgatttcttctacacagaggatgggggcatctacttgaat
gagctcaataccatgcctggctttacccaatggtctatgtatcccttgttgtgggacaac
atgggcttgtcctatcctgatttgatcgagcgtttggttgagttggcaaaagcaactttc
gaaaaacgcgaagcacacttactgtaa

DBGET integrated database retrieval system