KEGG   Streptococcus sp. A12: ATM98_02435Help
Entry
ATM98_02435       CDS       T05522                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
stra  Streptococcus sp. A12
Pathway
stra00010  Glycolysis / Gluconeogenesis
stra00020  Citrate cycle (TCA cycle)
stra00620  Pyruvate metabolism
stra01100  Metabolic pathways
stra01110  Biosynthesis of secondary metabolites
stra01120  Microbial metabolism in diverse environments
stra01130  Biosynthesis of antibiotics
stra01200  Carbon metabolism
Module
stra_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:stra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ATM98_02435
   00020 Citrate cycle (TCA cycle)
    ATM98_02435
   00620 Pyruvate metabolism
    ATM98_02435
Enzymes [BR:stra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ATM98_02435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: AMP66635
UniProt: A0A127TRU2
LinkDB All DBs
Position
476923..477966
Genome map
AA seq 347 aa AA seqDB search
MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIAL
EHNIAWQEIQGTGHRGKIMKKDVLAFLPENIENETIKSPAQIEKVEEVPDNVTPYGEIER
IPMTPMRKVIAQRMVESYLTAPTFTLNYDIDMSQMLALRKKVLDPIMEATGKKVTVTDLL
SLAVVKTLMKHPYINASLTEDGKTIITHNYVNLAMAVGMDNGLMTPVVYNAEKMTLSELV
VAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSATVEKPV
VVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKALIEDPISMLV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgataagctaagagcgactcctgcggctagaaaattagcggatgatcttggg
atcaacctctatgatgtttctggttcaggcgcaaacggtcgtgtccacaaagaagacgtg
gaaacatataaagacacaaatgtggttcgcatttcaccacttgcaaaacgaattgcttta
gaacacaatattgcttggcaagaaatccaaggaactggtcatcgtggtaaaattatgaag
aaggacgtccttgctttccttcctgaaaatattgagaatgagaccattaagtcacctgct
caaattgagaaagtcgaagaagttcctgataatgtgacaccttatggtgagatcgagcgg
attccgatgacaccaatgcgtaaggtaatcgctcaacggatggtggaatcttacttgaca
gcaccaacctttactttgaactatgacattgatatgtctcaaatgttggcccttcgtaag
aaggtattggatccaatcatggaggccactggcaagaaagtcactgtaacagatttgctt
tctctagcagtggttaagaccttgatgaaacatccatacatcaatgcgtcattaacagaa
gatggcaaaaccatcatcactcacaattatgtcaacttagcgatggcagttgggatggac
aatggattgatgactccagttgtctacaatgctgaaaagatgaccttgtcagagttggtc
gtagccttcaaggatgttatcggacgtaccttggatggtaagcttgctccaagtgaattg
caaaactcaacctttaccatcagtaacttgggaatgtttggcgttcaatcatttggacca
attatcaaccaaccaaattctgccatccttggcgttagtgcaacggttgaaaaaccagtg
gttgtgaatggtgaaattgttattcgtccaatcatgagcttgggcttgaccattgaccac
cgagtagtcgatgggatggctggtgccaaattcatgaaagacttgaaagccttgattgaa
gacccgatttcaatgttggtctaa

DBGET integrated database retrieval system