KEGG   Streptococcus sp. A12: ATM98_03615Help
Entry
ATM98_03615       CDS       T05522                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
stra  Streptococcus sp. A12
Pathway
stra00500  Starch and sucrose metabolism
stra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ATM98_03615
Enzymes [BR:stra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ATM98_03615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AMP66860
UniProt: A0A127TSJ0
LinkDB All DBs
Position
727394..728845
Genome map
AA seq 483 aa AA seqDB search
MENQTLMQYFEWYLPSDGQHWTRLAADAPHLADLGIRKIWMPPAFKATSANDVGYGVYDL
FDLGEFDQKGTVRTKYGFKEDYLQAIQALKEAGIQPMADVVLNHKAAADGLEKFEVVEVD
PNDRTIVLTEPFTIKGWTKFTFDGRNGAYNDFHWHWYHFTGTDYDASRNKSGIYQIQGEN
KGWAQDDLVDSENGNYDYLMYADIDFKHPEVVENLNQWAEWFIETTEVEGFRLDAVKHID
SFFMKNFIQQITDKYGDDFYVFGEFWNGDEQSNNDYLASIDYQFDLVDVALHQNLFRASQ
EGENFDLTTIFNGTLASNHPESAVTFVDNHDTQRGQALESTVGEWFKPAAYALILLREAG
LPCVFYGDYYGISGDFAQQDFQAELDQLLRIRKDLSYGEQKDYFDDPNCIGWTRSGTEES
APIACVISNAAASAKRMEIGQAYAGQTYYDALGNYQEPVQIQEDGWADFPVSERSVSVWI
LAD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaaaccttaatgcaatattttgaatggtacttaccctcagatggccaacac
tggacccgcttagctgcagatgcccctcacctggcagacttgggcattcgtaaaatctgg
atgccacctgcttttaaagcaacatctgccaatgatgtcggctatggcgtctatgacctc
tttgaccttggagaatttgaccaaaaagggactgtccgcaccaagtatggattcaaagag
gactacttgcaagccatccaggccttaaaagaagctggaatccagcccatggctgatgtg
gtgctcaaccataaggcagcagccgatggccttgaaaagtttgaagtggtcgaagtggac
cctaacgatcggaccatcgtcttgactgagccttttactatcaaaggatggacaaaattt
acctttgatggtcgaaatggtgcctacaatgacttccactggcactggtaccacttcacc
ggtaccgactacgatgcttcccgcaataagagtggcatctaccaaatccaaggggaaaac
aaaggttgggctcaggatgatctggtcgacagcgaaaacggcaactatgattacctcatg
tacgctgatatcgacttcaaacacccagaagtggtcgaaaacctcaaccaatgggctgaa
tggtttattgaaacaactgaggtagaaggcttccgtctcgatgcggttaaacacatcgac
tccttctttatgaagaacttcatccagcaaatcacggacaaatacggagacgatttctat
gtatttggtgagttttggaacggggatgaacaaagcaacaatgactacctagccagcatt
gactaccagttcgacttagtcgacgttgccctccaccaaaatctctttagagctagccaa
gaaggggaaaactttgatttaaccactattttcaatggtacactcgcaagcaatcatcca
gaaagtgctgtaacctttgtcgataatcacgatacccagagaggacaagctttagagtct
actgttggtgaatggttcaaacctgccgcttatgccctcattctcctccgcgaggctgga
cttccatgtgtcttttacggagactattacgggatttcaggggactttgcccagcaggat
ttccaagccgagcttgatcaactccttcgtatccgcaaagacttatcctacggtgaacaa
aaagactactttgacgatcctaactgcattggttggactcgctctggaacggaagagtct
gctcctatcgcctgcgtgatttcaaatgcggctgcatctgccaaacgcatggaaatcggc
caagcatatgcagggcagacctactacgatgccctaggaaattaccaagaacccgttcaa
atccaagaagacggctgggctgatttcccagtctcagaacgctctgtcagcgtatggatt
ttggcagactaa

DBGET integrated database retrieval system