KEGG   Streptococcus sp. A12: ATM98_05025Help
Entry
ATM98_05025       CDS       T05522                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
stra  Streptococcus sp. A12
Pathway
stra00220  Arginine biosynthesis
stra00250  Alanine, aspartate and glutamate metabolism
stra00290  Valine, leucine and isoleucine biosynthesis
stra01100  Metabolic pathways
stra01110  Biosynthesis of secondary metabolites
stra01130  Biosynthesis of antibiotics
stra01210  2-Oxocarboxylic acid metabolism
stra01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ATM98_05025
   00290 Valine, leucine and isoleucine biosynthesis
    ATM98_05025
   00220 Arginine biosynthesis
    ATM98_05025
Enzymes [BR:stra01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ATM98_05025
    2.6.1.66  valine---pyruvate transaminase
     ATM98_05025
Amino acid related enzymes [BR:stra01007]
 Aminotransferase (transaminase)
  Class I
   ATM98_05025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AMP67132
UniProt: A0A127TT96
LinkDB All DBs
Position
complement(1019197..1020411)
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSVKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYSQLKKIPNVEIDDIYIGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYVCDEEAEWYPDIDDIKSKITSNTKAIVVINPNNP
TGALYPDEILLEIVEIARQHGLIIFADEIYDRLVMDGAKHTAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKHHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGYQSVDELL
LPGGRIYEQRNFIYKAINDIPGLSAVKPKAGLYIFPKIDREMYRVDDDEQFVLNFLKQEK
VLLVHGRGFNWKEPDHFRIVYLPRVEELAQIQEKMTRFLKQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatacaataagtccgtcaagctagagcacgttgcttacgatattcgtggtcca
gtcttagaagaagcgatgcgcatgcgggcaaacggggagaaaatccttcgcttaaataca
ggaaatccggctgaatttgggttcacggctcccgatgaagtcattcatgatttgattatg
aatgctcgggatagtgaagggtattcggattcaaaaggaattttttctgcccgtaaggcc
attatgcagtatagccaattgaaaaagattccgaatgttgagattgatgatatctatatc
ggaaatggtgtcagtgagttgattgtgatgtctatgcaaggcttgctcgataatggcgat
gaagtacttgtgccaatgccagactatccactttggacagcagcagtcagcctagcaggt
ggaaatgcggtgcattatgtctgtgatgaagaagcagagtggtacccagatatcgatgat
atcaagtcaaaaattacctcaaacaccaaggctatcgtcgtgatcaacccaaataaccca
accggagctctctatccagatgagattctgttggaaattgtcgaaattgctcgtcaacat
ggcttgattatttttgcagatgagatttatgatcgcttggtcatggatggtgccaaacac
acagctattgctagtctcgcgccagatttgttctgtgtcagcatgaacggtttgtccaaa
tcacaccgcatcgcgggcttccgtgtgggctggatggtcttgtctggaccaaaacaccac
gtgaagggctatatcgaaggtttgaatatgctctccaatatgcgtctgtgttcaaacgtc
ttggcccaacaagtggtccagacttctttgggaggctaccagtcagtggacgaactcttg
cttccaggcggtcgaatctacgaacaacggaactttatctacaaggctatcaatgatatc
ccagggctttcagctgtcaaaccaaaagctggtctctatatcttccctaagattgatcgt
gaaatgtaccgggtagatgatgatgagcagtttgtcttgaatttcttaaaacaagaaaag
gttcttttggttcacggacgtggatttaactggaaagagccagatcatttccggattgtt
taccttcctcgagtagaagaattggctcaaattcaagagaagatgactcgtttcttaaaa
caatacaaacgataa

DBGET integrated database retrieval system