KEGG   Streptomyces sp. CNQ-509: AA958_09215Help
Entry
AA958_09215       CDS       T03968                                 

Definition
(GenBank) neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00511  Other glycan degradation
strc00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:strc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AA958_09215
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AA958_09215
Enzymes [BR:strc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AA958_09215
Bacterial toxins [BR:strc02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AA958_09215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR BNR_3 Laminin_G_2 Laminin_G_1
Motif
Other DBs
NCBI-ProteinID: AKH82377
UniProt: A0A0F7N6E1
LinkDB All DBs
Position
complement(2215443..2217176)
Genome map
AA seq 577 aa AA seqDB search
MLFQAGTGGYFCYRIPAVVEAADGTLLAFAEGRVDSCADKGDIDIVLRRSTDGGATWSAP
QVVLAGDGDTRGNPAPVVDRETGRISLLSTHNPGADDTVRTPYLQHSTDNGRTWSAARNM
GAELSKPEWDRWYATGPGHGLQLTTGDHAGRLLVGGNHQGLDGRQGAHLLYSDDGGLTWQ
LGADDTRAVQPPDVKPQELSLFERRDGSVYAAARDERGTDPGNRAAAVSSDGGTTFDAPF
ATTPDLVSPVVQGATLRHGDQILASLPAHPADRKVMSVRASRDDGATWEPWQQGRVIHWG
PTAYSDMAGLDGDRVGLLYEAGTAGPYETIRWARFNDAFLDQPNDDPPQPPAPAPGATTP
DVSGSGNTAYVRGSSHLRPGRFGQSLYLDNAAPHIDARVEVPWNDSLDVGDGDFTWTGWF
KYGRTNGAHAIMWAYGVGGNAPSVWLRAEPEQNRIIARMQMEQAAVSVQTTGAYNDNAFH
FVTLQRAGGKLTLSVDGTSYAADAPPGSPTAGSEFGIGGIDVGQRLDGANRFHGYLDDMR
VYDRALTRGELTAVRKDNAPVPRGQQLRLPLDTVTPQ
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgctcttccaggccggcaccggcggctacttctgctaccgcatccccgccgtcgtcgaa
gccgccgacggcaccctcctggccttcgccgaaggccgcgtcgacagttgcgccgacaaa
ggcgacatagacatcgtgctgcgccgctccaccgacggcggcgccacctggagcgccccg
caggtcgtcctcgccggcgacggcgacacccgcggcaaccccgcccccgtcgtcgaccgc
gaaaccggccgcatctccctcctcagcacccacaaccccggcgccgacgacaccgtccgc
accccctacctccagcactccaccgacaacggccgcacctggagcgccgcccgcaacatg
ggcgccgaactctccaagccggaatgggaccgctggtacgccaccggacccggccacggc
ctccagctcaccaccggcgaccacgcgggacgcctcctcgtcggcggcaaccaccagggc
ctcgacggccgccagggcgcccacctcctctacagcgacgacggcggcctcacctggcag
ctcggcgccgacgacacccgcgccgtccagccgcccgacgtcaaaccccaggaactcagc
ctcttcgaacgccgggacggctccgtctacgccgccgcccgcgacgaacgcggcaccgac
cccggcaaccgcgccgccgccgtcagcagcgacggcggcaccaccttcgacgcccccttc
gccaccacccccgacctcgtcagccccgtcgtccagggcgccaccctccgccacggcgac
cagatcctcgcctccctgcccgcccaccccgccgaccgcaaggtcatgtccgtacgcgcc
tcccgcgacgacggcgccacctgggaaccctggcagcagggccgcgtcatccactggggc
cccaccgcctactccgacatggccggactcgacggcgaccgcgtcggcctcctctacgaa
gccggcaccgcaggaccgtacgagacgatccgctgggcccgcttcaacgacgccttcctc
gaccagcccaacgacgacccgccgcaaccccccgcccccgcccccggagccaccaccccc
gacgtctccggcagcggcaacaccgcctacgtccgcggcagctcccacctgcgccccggg
cggttcggccagtccctctacctcgacaacgccgccccccacatcgacgcccgcgtcgag
gtcccctggaacgactccctcgacgtcggcgacggcgacttcacctggaccggctggttc
aagtacggccgcaccaacggcgcccacgcgatcatgtgggcctacggagtcggcggcaac
gccccctccgtctggctgcgcgcggaacccgagcagaaccgcatcatcgcccgcatgcag
atggaacaggccgccgtcagcgtccagaccaccggcgcgtacaacgacaacgccttccac
ttcgtgaccctgcagcgcgccggcggaaaactcaccctcagcgtcgacggcacctcctac
gccgccgacgccccgcccggctcacccaccgcgggcagcgagttcggcatcggcggcatc
gacgtcggccagcgcctcgacggcgccaaccgcttccacggctacctcgacgacatgcgc
gtctacgaccgcgccctcacccgcggcgaactgaccgccgtccgcaaggacaacgccccc
gtcccccggggccagcagctccgcctccccctcgacaccgtcaccccgcagtag

DBGET integrated database retrieval system