KEGG   Streptomyces sp. CNQ-509: AA958_12025Help
Entry
AA958_12025       CDS       T03968                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00620  Pyruvate metabolism
strc00680  Methane metabolism
strc01100  Metabolic pathways
strc01120  Microbial metabolism in diverse environments
strc01200  Carbon metabolism
Module
strc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AA958_12025
  09102 Energy metabolism
   00680 Methane metabolism
    AA958_12025
Enzymes [BR:strc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AA958_12025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase DUF1959
Motif
Other DBs
NCBI-ProteinID: AKH82840
UniProt: A0A0F7N2M2
LinkDB All DBs
Position
complement(2883390..2886182)
Genome map
AA seq 930 aa AA seqDB search
MTSADTHAPRPAGAAGPDPDAAAAGNAELRADIRRLGDLLGETLVRQDGPELLDLVERVR
ALTRTDGDAAAELLRTVDLETAARLVRAFSTYFHLANVTEQVHRGREFRARRAAEGGSLA
RTADMLKDADPAHLRETIASLGVRPVFTAHPTEAARRSVLTKLRDVARLLEADEGASTAD
RRRCDRRLAEDIDLIWQTDELRVVRPEPADEARNAIYYLDELNRGAVGDVLEDLAAELER
VGVDQSAVLPPGTRPLTFGTWIGGDRDGNPNVTPQVTWDVLLLQHEHGITEAIGHVDELR
SALSNSIRNGGATEELLESVQRDLEVLPEISPRYKRLNAEEPYRLKATCIRQKLLNTRRR
LAEGSAHVPGRDYLGTAQLIDELTLVQTSLRAHRGSLVADGRLERTIRTIAAFGLQLATM
DVREHADAHHHALGQLFDRLGEESWRYLDMPRDYRRGLLAKELRSRRPLAPTPAPLDEAG
TKTLGVFETVRKAIDAFGPEVIESYIISMCQGADDVFAAAVLAREAGLLDLHAGWAKIGI
VPLLETTDELKIADDLLDAMLSDPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIH
RAQRRLRDVAHRHGVRLRLFHGRGGTVGRGGGPTHDAILAQPWGTLEGEIKVTEQGEVIS
DKYLVPSLARENLELTVAATLQASALHTAPRQSVEALTRWDAAMDVVSDAAHAAYRRLVD
DPDLPAYFFASTPVDQLAELHLGSRPSRRPDTGAGLDGLRAIPWVFGWTQSRQIVPGWFG
VGSGLRAAREAGLDAVVDEAYEHWHFFRNFLANVEMTLAKTDLRIARHYVDTLVPDELKH
IFAVIEAEHELTVSEVLRITGESELLEANPVLQQTFRIRDAYLDPISYLQVTLLGRQREA
AERGEAPDPLLGRALLLTVNGVAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtgccgacacccacgcgccccgccccgccggagccgcaggcccggacccggac
gccgcggccgccggcaacgccgagctgcgcgccgacatccggcgcctcggcgacctgctc
ggcgagacgctcgtccgccaggacgggccggaactgctggacctcgtcgaacgcgtacgc
gccctgacgcgcaccgacggcgacgccgccgcggagctgctgcgcaccgtcgacctggag
accgccgcccggctcgtgcgcgccttctccacctacttccacctcgccaacgtcaccgag
caggtgcaccgcggccgcgagttccgcgcccgccgcgccgcggagggcggcagcctggcc
cgtaccgccgacatgctgaaggacgccgaccccgcgcacctgcgcgagaccatcgccagc
ctcggcgtacgccccgtcttcaccgcccaccccaccgaggccgcgcgccgctccgtcctc
accaagctgcgcgacgtggcccgcctcctggaggccgacgagggcgcgtccaccgccgac
cgccgccgctgcgaccgccgcctcgccgaggacatcgacctcatctggcagaccgacgag
ctgcgcgtcgtccggcccgaacccgcggacgaggccaggaacgccatctactacctggac
gagctgaaccgcggcgccgtcggcgacgtgctcgaagacctcgccgcggaactggagcgc
gtcggcgtcgaccagtccgccgtcctgccgcccggcacccgcccgctcaccttcggcacc
tggatcggcggcgaccgcgacggcaaccccaacgtgaccccccaggtcacctgggacgtg
ctcctcctccagcacgagcacggcatcaccgaggccatcggccacgtggacgagctgcga
tccgccctctccaactccatccgcaacggcggcgccaccgaggaactcctcgaatcggtc
cagcgcgacctggaggtgctccccgagatcagcccccgctacaagcggctcaacgccgag
gagccctaccggctcaaggccacctgcatccggcagaagctcctcaacacccgccgccgg
ctcgccgagggcagcgcccacgtgcccggccgcgactacctcggcaccgcgcagctcatc
gacgaactcaccctcgtccagacctcgctgcgcgcgcaccgcggctcgctcgtcgccgac
ggccggctggagcgcaccatccgcaccatcgccgccttcggcctccagctcgccaccatg
gacgtacgcgagcacgccgacgcccaccaccacgcgctcggccagctcttcgaccggctc
ggcgaggagtcctggcgctacctggacatgccgcgcgactaccgccgcggcctcctcgcc
aaggagctgcgctcccgccgcccgctggcgcccacccccgcgccgctcgacgaggccggc
accaagaccctcggcgtcttcgagaccgtcaggaaggccatcgacgccttcgggcccgag
gtcatcgagtcgtacatcatctccatgtgccagggcgccgacgacgtgttcgccgccgcc
gtcctcgcccgcgaggccgggctgctggacctgcacgccggctgggcgaagatcggcatc
gtgccgctgctggagaccaccgacgagctgaagatcgccgacgacctcctcgacgcgatg
ctctccgacccctcctaccggcgcctggtctccctgcgcggggacgtccaggaggtcatg
ctcgggtactccgactcctccaagttcggcggcatcaccacctcccagtgggagatccac
cgcgcccagcgccggctgcgcgacgtcgcccaccggcacggcgtacggctgcggctcttc
cacggccgcggcggcaccgtcggccgcggcggcggccccacccacgacgcgatcctcgcc
cagccgtgggggaccctcgaaggcgagatcaaggtcaccgagcagggcgaggtcatctcc
gacaagtacctcgtgccgtccctggcccgggagaacctggagctgaccgtcgccgccacc
ctccaggcgtccgccctgcacaccgcgccgcggcagtccgtcgaggcgctgacccgctgg
gacgccgcgatggacgtcgtctccgacgccgcgcacgccgcgtaccggcggctcgtcgac
gaccccgacctgcccgcgtacttcttcgcctccacgcccgtcgaccagctcgccgagctg
cacctcggctcccggccctcccgccgtcccgacaccggcgcgggcctcgacgggctgcgc
gccatcccgtgggtcttcggctggacgcagtcccggcagatcgtccccggctggttcggc
gtcggctccgggctgcgtgccgcccgggaggcggggctcgacgcggtggtggacgaggcg
tacgagcactggcacttcttccgcaacttcctcgccaacgtcgagatgacgctcgccaag
accgacctgcggatcgcccggcactacgtcgacaccctcgtgcccgacgagctgaagcac
atcttcgcggtcatcgaggccgagcacgagctgacggtcagcgaggtgctgcgcatcacc
ggcgagtcggagctgctggaggccaacccggtgctccagcagacgttccgcatccgcgac
gcctacctcgacccgatctcgtacctccaggtcacgctcctcggccggcagcgcgaggcg
gccgaacgcggcgaggcccccgacccgctgctgggccgggcgctgctgctgacggtgaac
ggcgtggcggcgggcctccgcaacacgggctga

DBGET integrated database retrieval system