KEGG   Streptomyces sp. CNQ-509: AA958_13245Help
Entry
AA958_13245       CDS       T03968                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00630  Glyoxylate and dicarboxylate metabolism
strc01100  Metabolic pathways
strc01110  Biosynthesis of secondary metabolites
strc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AA958_13245
Enzymes [BR:strc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     AA958_13245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD HAD_2 Hydrolase_like Hydrolase
Motif
Other DBs
NCBI-ProteinID: AKH86735
UniProt: A0A0F7NE32
LinkDB All DBs
Position
3186367..3186957
Genome map
AA seq 196 aa AA seqDB search
MTLIDSRPGIKAVYEAIVAETGVYVDTDLVTSRLGPPVESELANWFPADRVAALGDRYRA
LYPDHGITPTAALPGAAAAIAAVQAAGGRALVVTAKSRPLAKLHIDHLGLAPDAVVGGLW
ADAKAEALTEYGASAYVGDHVGDVAGARAARVLSVAVATGPCPAAELRAAGADVVLPDLT
AFPGWLAEHRAGAAGG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcatcgactcccggccggggatcaaggcggtgtacgaggcgatcgtcgccgag
accggcgtgtacgtcgacaccgacctcgtgacctcccgcctcggcccgccggtggagagc
gagctggcgaactggttccccgccgaccgcgtggccgccctcggcgaccgctaccgcgcc
ctctaccccgaccacggcataacccccaccgcagccctgcccggcgccgccgcggcgatc
gcggcggtgcaggcggcgggcggccgggcgctcgtggtcaccgccaagagccggccgctg
gcgaagctgcacatcgaccacctgggcctggccccggacgcggtggtcggcgggctgtgg
gcggacgcgaaggcggaggcgctcaccgagtacggggcgtcggcgtacgtcggcgaccac
gtcggcgacgtcgcgggggcgcgggcggcgcgggtgctgtcggtggcggtggccacgggg
ccgtgcccggcggcggagctgcgggcggcgggggcggatgtcgtgctgccggacctgacg
gcgttcccggggtggctggcggagcaccgggcgggggcggcgggcggctga

DBGET integrated database retrieval system