KEGG   Streptomyces sp. CNQ-509: AA958_15250
Entry
AA958_15250       CDS       T03968                                 

Definition
(GenBank) amidohydrolase
Organism
strc  Streptomyces sp. CNQ-509
SSDB
Motif
Pfam: Peptidase_M28 PA Peptidase_M20 Peptidase_M42 DUF4910 Nicastrin
Other DBs
NCBI-ProteinID: AKH83347
UniProt: A0A0F7N9H0
LinkDB
Position
3611841..3613373
AA seq 510 aa
MFPRRFTAALGAAALAVPLLLASSAPAGAAQPAKDGAKLARDLVRASSAADAYKHLKAFQ
RIADRNGGHRAAGSPGYEASAAYVYDQLKQAGYDVGYDTFDFTYSETLKDEFAVVSPEAR
DIEIFAMTFSKSTPEGGLDAPLAAVPVDADGTSGCEPGDFTGGDYTGKVALVQRGGCNFS
VKQAHAADAGAVATVIYNNTEGALNGTLGDADAVKVPTGGITKAEGEALTTLLTQGEVTV
HVDIQTIVEPRTTRNVIAETRGGAEDRTVMLGAHLDSVAEGAGINDNASGSAALLEVAKE
LAKAEKKPRNQVRFAFWSAEELSLVGSTDYVSRLTPRQLRDIELYLNFDMVASPNYGLFV
YDGDDSDGVGEGPGPEGSAQLERQITDFMDRKGMPHEGTDFTGRSDYGPFIEVGIPSGGT
FTGAEGTKTEAQAVKFGGTAGKAYDPCYHTACDDLDNISMPAFDANIDVIAHAVGTYAHD
VSSLREPVSFVPTEGDEGSGGGAHDDHAER
NT seq 1533 nt   +upstreamnt  +downstreamnt
gtgttccctcgaagattcacggctgcgctgggcgcggccgccctcgccgtccccctgctc
ctggccagctcggcgcccgccggcgcggcacaaccggcgaaggacggcgcgaagctggcc
cgggacctggtgcgcgcgtccagtgctgcggacgcgtacaagcacctcaaggcgttccag
cggatcgcggaccgcaacggcggccaccgcgcggccggttcgccggggtacgaggcgtcc
gccgcgtacgtctacgaccagctcaagcaggccggctacgacgtcgggtacgacaccttc
gacttcacctactccgagacgctgaaggacgagttcgccgtcgtctcgcccgaggcgcgg
gacatcgagatattcgcgatgaccttctcgaagtcgacccccgagggcggcctcgacgcg
ccgctggctgccgtgcccgtcgacgccgacggcacctcgggctgcgagccgggcgacttc
acgggcggcgactacacgggcaaggtcgcgctcgtccagcgcggcggctgcaacttctcc
gtcaagcaggcccacgccgcggacgcgggcgccgtcgccaccgtcatctacaacaacacc
gagggcgccctcaacgggaccctcggcgacgccgacgcggtcaaggtgcccaccggcggc
atcaccaaggccgagggcgaggccctgaccacgctgctgacgcagggcgaggtcaccgtc
cacgtcgacatccagacgatcgtcgagccgcggacgacgcggaacgtcatcgccgagacc
aggggcggcgccgaggaccgcaccgtcatgctcggcgcgcacctcgactcggtcgccgag
ggcgccggcatcaacgacaacgcctcgggctccgcggcgctgctggaggtcgcgaaggaa
ctggcgaaggcggagaagaagccgcgcaaccaggtgcgcttcgcgttctggtcggcggag
gagctgagcctcgtcggctccacggactacgtgagccggctcaccccgcgccagttgcgg
gacatcgagctgtacctgaacttcgacatggtcgcctcgccgaactacggcctcttcgtc
tacgacggcgacgactccgacggcgtcggcgagggcccggggcccgagggctcggcgcag
ttggagcggcagatcaccgacttcatggacaggaaggggatgccgcacgagggcaccgac
ttcaccggccgctccgactacggccccttcatcgaggtgggcatcccgtccggcggcacg
ttcacgggcgcggaggggacgaagaccgaggcgcaggccgtgaagttcggcggcacggcg
ggcaaggcgtacgacccgtgctaccacacggcgtgcgacgacctggacaacatcagcatg
ccggcgttcgacgcgaacatcgacgtcatcgcccacgcggtcgggacgtacgcgcacgac
gtcagctcgctgcgcgagccggtgtcgttcgtgcccaccgagggcgacgagggcagcggc
gggggtgcgcacgacgaccacgcggagcggtga

DBGET integrated database retrieval system