KEGG   Streptomyces sp. CNQ-509: AA958_15575Help
Entry
AA958_15575       CDS       T03968                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00250  Alanine, aspartate and glutamate metabolism
strc00410  beta-Alanine metabolism
strc00430  Taurine and hypotaurine metabolism
strc00650  Butanoate metabolism
strc01100  Metabolic pathways
strc01110  Biosynthesis of secondary metabolites
strc01120  Microbial metabolism in diverse environments
strc02024  Quorum sensing
Module
strc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AA958_15575
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AA958_15575
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AA958_15575
   00430 Taurine and hypotaurine metabolism
    AA958_15575
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AA958_15575
Enzymes [BR:strc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AA958_15575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AKH83393
UniProt: A0A0F7N7M1
LinkDB All DBs
Position
complement(3679151..3680533)
Genome map
AA seq 460 aa AA seqDB search
MALHQTERGVAGPYDDVYAMPISEHALPKYFMPEEVSDPRAVNALIRDELALDGNAAQNL
ATFCTTWAEDEVHSLMDECIGKNMVDKDEYPQTADIENRCVHILADLWHSPHGETTMGCS
TTGSSEAAMLGGLALKWRWRTRRKAEGKPADRPNLVCGPVQVCWEKFARYFDVELRQVPL
EPDATGLRPHQLREYVDENTIGVVAILGVTYTCDYEPVKEIAAELDAIQADTGLDVPVHV
DAASGGFVAPFLRPELEWDFRVERVASINSSGHKYGMAPLGVGWAIWRSADLLPEDLIFR
VSYLGGDMPTFALNFSRPGGEVVAQYYNLLRLGRAGYRRIYRAAAGSAEWLGEQIAGMGP
FTLLYDGRGALPAVSWTLTDPAGAGFTLYDVTEQLRLRGWQVPAYPLPPRRQETVIQRVL
IRHGISHDKIELLAADVREALDRLKDGAGTPAPQQPAFHH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtggccctgcaccagaccgagcgcggcgtcgccggaccgtacgacgacgtctacgcgatg
cccatcagcgagcacgcgctgcccaaatacttcatgcccgaggaggtctccgacccgcgc
gccgtcaacgcgctcatccgcgacgagctggccctcgacggcaacgccgcgcagaacctg
gcgacgttctgcaccacctgggccgaggacgaggtgcacagcctcatggacgagtgcatc
ggcaagaacatggtcgacaaggacgagtacccgcagaccgcggacatcgagaaccgctgc
gtgcacatcctcgccgacctgtggcactccccgcacggcgagacgaccatgggctgctcg
accaccggctccagcgaggccgcgatgctcggcggcctggcgctcaaatggcgctggcgc
acgcgccggaaggccgagggcaagcccgccgaccggccgaacctggtgtgcggtcccgtg
caggtgtgctgggagaagttcgcccgttacttcgacgtcgagctgcgccaggtgccgctg
gagccggacgccaccgggctgcgcccgcaccaactccgcgagtacgtcgacgagaacacc
atcggcgtcgtcgccatcctcggcgtcacatacacctgcgactacgagccggtcaaggag
atcgccgcggaactcgacgcgatccaggccgacacgggcctggacgtgcccgtgcacgtg
gacgccgccagcggcggcttcgtcgccccgttcctccgccccgagctggagtgggacttc
cgggtggagcgggtggcgtccatcaactcctccggccacaagtacggcatggcgcccctc
ggcgtcggctgggcgatctggcgctccgccgacctgctgcccgaggacctgatcttccgc
gtcagctacctcggcggcgacatgccgacgttcgcgctgaacttctcccggcccggcggc
gaggtcgtcgcgcagtactacaacctgctgcggctgggccgcgcgggctaccgccgcatc
taccgcgcggcggccggcagcgccgagtggctgggcgagcagatcgccggcatgggcccg
ttcacgctgctgtacgacgggcgcggcgcgctgccggcggtgtcgtggacgctgacggac
ccggcgggcgcgggcttcacgctgtacgacgtgacggagcaactgcggctgcgcggctgg
caggtcccggcgtacccgctgccgccgcggcggcaggagacggtcatccagcgggtgctg
atcaggcacgggatcagccacgacaagatcgagctgctggcggcggacgtacgggaggcg
ctcgaccggctgaaggacggggccggaacaccggcgccgcagcagccggccttccaccac
tga

DBGET integrated database retrieval system