KEGG   Streptomyces sp. CNQ-509: AA958_23785Help
Entry
AA958_23785       CDS       T03968                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
strc  Streptomyces sp. CNQ-509
Brite
KEGG Orthology (KO) [BR:strc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AA958_23785
Enzymes [BR:strc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AA958_23785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: AKH86996
UniProt: A0A0F7NFE4
LinkDB All DBs
Position
complement(5486170..5486565)
Genome map
AA seq 131 aa AA seqDB search
MFSRLFAPKVTVSAHCDLPCGVYDPAQARIEAESVKAIQEKMQGNDDPHFQARATTIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSTDPATGQKALDYIAQ
VDKIFWETKQG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgttttctcgcctgttcgcccccaaggtgacggtcagtgcccactgcgacctcccctgc
ggcgtctacgacccggcccaggcccgtatcgaggccgaatcggtcaaggccatccaggag
aagatgcagggcaacgacgacccgcacttccaggcgcgggccaccaccatcaaggagcag
cgcgcggagcttgccaagcaccacgtttcggtgctgtggagcgactacttcaagcccccg
cacttcgagaagtaccctgagctgcaccagctcgtcaacgacacgctcaaggccctcagc
gccgccaagggctccaccgacccggccacgggccagaaggcgctggactacatcgcccag
gtcgacaagatcttctgggagaccaagcagggctga

DBGET integrated database retrieval system