KEGG   Streptomyces sp. CNQ-509: AA958_31995Help
Entry
AA958_31995       CDS       T03968                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
strc  Streptomyces sp. CNQ-509
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase FANC_SAP
Motif
Other DBs
NCBI-ProteinID: AKH86076
UniProt: A0A0F7NCY7
LinkDB All DBs
Position
7532515..7533600
Genome map
AA seq 361 aa AA seqDB search
MDLPVMPPVKPMLAKPQKKLPPGMLYEAKWDGFRAIVFRDGAEVEIGSRTGKPLTRYFPE
LVEALQANLPERCVLDGEIVIVRGDRLDFDALTERIHPADSRVRMLAEQTPASFVAFDLL
ALGDDSLLDTAQSERRAALLRALAGARAPVHIAPATTDLAVAGEWFEQYEGAGLDGIIAK
PADLPYRQNERVLVKVKHERTADVVLAGFRWHKSGPVVGSLLLGINDDKGVLQHVGVCAA
FSMTRRAELVEELAPLRMETPEEQAAHPWADWAKEEAHESARLPGAPSRWSGQKDLSWVP
LRPERVLEVAYDHMENGARFRHTAQFRRWRPDRTPESCTYEQLEEPVTYDLNEVLATPKE
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccggtgatgccccccgtgaagccgatgctcgccaagccgcagaagaagctc
ccgcccgggatgctctacgaggcgaagtgggacggcttccgcgccatcgtcttccgcgac
ggcgccgaggtcgagatcggcagccgcaccggcaagccgctcacccgctacttccccgag
ctggtcgaggcgctccaggccaacctgcccgagcggtgcgtcctggacggcgagatcgtc
atcgtgcgcggcgaccggctcgacttcgacgccctcaccgagcgcatccaccccgcggac
tcgcgggtgcggatgctcgccgagcagaccccggcgagcttcgtcgcgttcgacctgctg
gccctcggcgacgactcgctgctggacaccgcgcagtccgagcggcgcgcggcgctgctg
cgcgcgctggccggcgcccgggcgcccgtgcacatcgcgccggcgacgacggacctggcg
gtcgcgggggagtggttcgagcagtacgagggcgccgggctcgacgggataatcgccaag
ccggccgacctgccgtaccggcagaacgagcgggtgctcgtcaaggtcaagcacgagcgc
acggcggacgtggtgctcgccggcttccgctggcacaagtcggggccggtggtcggctcc
ctgctgctcggcatcaacgacgacaagggcgtgctgcagcatgtgggggtgtgcgcggcg
ttctcgatgacgcggcgggccgagctggtcgaggagctcgcgccgctgcggatggagacg
cccgaggagcaggcggcgcacccgtgggccgactgggcgaaggaggaggcgcacgagtcg
gcgcggctgccgggggcgccgagccggtggagcgggcagaaggacctgtcgtgggtgccg
ctgcggccggagcgggtgctggaggtcgcgtacgaccacatggagaacggggcccgcttc
cggcacaccgcgcagttccgccgctggcgccccgaccgcacgccggagagctgcacctac
gagcagttggaggagccggtcacgtacgacctgaacgaggtgctggccacccccaaggag
gagtga

DBGET integrated database retrieval system