KEGG   Streptomyces sp. CNQ-509: AA958_34040Help
Entry
AA958_34040       CDS       T03968                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00250  Alanine, aspartate and glutamate metabolism
strc00410  beta-Alanine metabolism
strc00640  Propanoate metabolism
strc00650  Butanoate metabolism
strc01100  Metabolic pathways
strc01120  Microbial metabolism in diverse environments
Module
strc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AA958_34040
   00650 Butanoate metabolism
    AA958_34040
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AA958_34040
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AA958_34040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:strc01007]
    AA958_34040
Enzymes [BR:strc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AA958_34040
Amino acid related enzymes [BR:strc01007]
 Aminotransferase (transaminase)
  Class III
   AA958_34040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKH86422
UniProt: A0A0F7NI29
LinkDB All DBs
Position
complement(7992450..7993715)
Genome map
AA seq 421 aa AA seqDB search
MTSLSPHLRQATPVTAERGEGVYLYGADGRRYLDFTAGIGVTSTGHCHPRVVAAAQEQVG
KLIHGQYTTVMHRPLRQLVERLGDVLPAGLDSLFFSNSGSEAVEAALRLARQATGRPNIV
VFHGGFHGRTVAAASMTTSGTKFRTGFSPLMSGVAIAPFPTAFRYGWDQETATRFALSEL
DYLLQTVTAPQETAAFTVEPVLGEGGYIQADPAFLRGLRQRADRHGIVLVMDEIQTGFGR
TGRFWGHDHAEDVRPDVITIAKGLASGFPLSGIASSQELMSKVLPGSQGGTYGGNAVACA
AAVATLDVIRDEKLVENADAMGQRLRAGLEEVAADTPGIADVRGLGLMLANEFVTADGSP
DPVTAARVQQAAAEEGLLLLMCGPWNNVVRMIPALVIDETAVDEGLAAWRAAVETGTAGS
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ttgaccagcttgtccccgcacctgcgccaagccacccccgtcactgccgagcgcggcgag
ggcgtctacctctacggcgccgacggccgccgctatctggacttcaccgctggcatcggc
gtcaccagcacgggtcactgccacccgcgtgtggtcgccgccgcgcaggagcaggtcggc
aagctcatccacggccagtacaccaccgtaatgcacaggccacttcggcaactggtcgag
cggctcggggacgtgctgcccgccggcctggacagcctgttcttctccaactccggcagt
gaggccgtcgaggcggcgctgcggctggcccggcaggccaccggccgtcccaacatcgtc
gtcttccacggaggcttccacggacgtaccgtcgccgccgcgtcgatgacgacatccggc
acgaagttccgcacagggttctcgccgctgatgtcgggtgtcgccatcgccccgttcccg
acggccttccgctacggctgggaccaggagactgcgacccgcttcgcgctcagcgagctc
gactacctgctccagaccgtcaccgctccgcaggagacggcggccttcaccgtcgagccc
gtcctcggcgagggcggctacatccaggccgaccccgccttcctgcgcgggctgcgccag
cgcgccgatcggcacggcatcgtgctggtgatggacgagatccagaccggcttcggccgc
accggccgcttctggggccacgaccacgccgaggatgtccgcccggacgtcatcaccatc
gccaaggggctggccagcggcttcccgctgtccggcatcgcctcctcccaggagctgatg
agcaaggtcctccccggctcgcagggcggcacctatggcggcaacgccgtcgcgtgcgcg
gccgcggtcgccaccctcgacgtgatccgcgacgaaaagctggtggagaacgctgacgcc
atgggacagcggctgcgcgccggcctggaggaggtcgccgccgacactccggggatcgcc
gacgtccgcggtctgggcctgatgctcgccaacgagttcgtcaccgccgacggctctccc
gacccggttaccgccgcgcgggtgcagcaggccgccgccgaggaggggctgctgctgttg
atgtgcggtccctggaacaacgtcgtgcggatgatcccggcgctggtcatcgacgagacg
gctgtcgacgagggcctcgccgcctggcgggccgccgtggaaacgggcacggcaggctcc
tcgtga

DBGET integrated database retrieval system