KEGG   Streptomyces sp. CCM_MD2014: NI25_04180Help
Entry
NI25_04180        CDS       T04862                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00020  Citrate cycle (TCA cycle)
strd00480  Glutathione metabolism
strd01100  Metabolic pathways
strd01110  Biosynthesis of secondary metabolites
strd01120  Microbial metabolism in diverse environments
strd01130  Biosynthesis of antibiotics
strd01200  Carbon metabolism
strd01210  2-Oxocarboxylic acid metabolism
strd01230  Biosynthesis of amino acids
Module
strd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
strd_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NI25_04180
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NI25_04180
Enzymes [BR:strd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NI25_04180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH Pr_beta_C
Motif
Other DBs
NCBI-ProteinID: AIV32822
UniProt: A0A0N6ZF86
LinkDB All DBs
Position
960553..962772
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVRAYASQAGVAVETRDISLAGRIIALFPEYLTEDQ
RIPDALAELGELAKTPAANIIKLPNISASIPQLKAAIAELQGQGYALPAYPDDPKTDEER
DVRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTGESKTNVATMGEND
FRSTEKSVVIAEDGALRIELVGDDGTTTVLRESVPVKKDEVVDASVLRVAALREFLTAQV
ARAKAEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFAQYGETLAKAGLTPNDGLGGI
YKGLESLPEGAEIKASFDAELAEGPELAMVDSDKGITNLHVPSDVIIDASMPAMIRTSGH
MWGADGGEHDALAVIPDSSYAGVYQAVIEDCRANGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPTTGTVRLVDAAGNAVLEQTVSAGDIFRACQTKDAPIRDWVKLAVTRARATGD
PAVFWLDEGRAHDANLIAKVKAYLPEHDTEGLDIRILDPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKEDYLRWD
SLGEFFALVPSLEQYAEATGNGKAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELAGQTDDADLAKAFAPLAETLTANEQKIVEELNAVQGKPAEIGGYYQPDPAK
AAKVMRPSATWNEALASLA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacacacactgacgaggccccggccctggcgacgtat
tcgttcctgccggtggtccgggcgtacgcctcgcaggcgggtgtcgcggtcgagacccgc
gacatctcgctggccggccgcatcatcgccctgttcccggagtacctcaccgaggaccag
cgcatcccggacgccctcgcggagctcggcgagctggccaagacgcccgccgccaacatc
atcaagctgccgaacatctcggcgtccatcccgcagctcaaggccgccatcgccgagctg
cagggccagggctacgcgctgccggcctacccggacgacccgaagaccgacgaagagcgc
gacgtccgcgcccgctacgacaaggtcaagggctccgcggtcaacccggtcctgcgcgag
ggcaactccgaccgccgcgccccggcgtcggtgaagaactacgccaagacccacccgcac
cgcatgggcgcctggaccggcgagtccaagaccaacgtggcgaccatgggcgagaacgac
ttccgttccacggagaagtccgtggtgatcgccgaggacggcgccctgcggatcgagctg
gtcggcgacgacggcaccaccacggtgctgcgcgagtcggtaccggtgaagaaggacgag
gtcgtcgacgcctccgtgctgcgcgtcgccgcgctgcgcgagttcctcaccgcgcaggtc
gcccgcgccaaggccgagggcgtcctgttctcggtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtggtccgcgccttcttcccgaagaccttcgcc
cagtacggcgagaccctcgccaaggccggcctcaccccgaacgacggcctgggcggcatc
tacaagggcctggagtccctgcccgagggcgccgagatcaaggcgtccttcgacgccgag
ctggccgagggcccggagctggccatggtcgactccgacaagggcatcaccaacctgcac
gtgccctcggacgtcatcatcgacgcctccatgccggccatgatccgcacctcgggtcac
atgtggggcgcggacggcggcgagcacgacgccctcgccgtgatcccggactcctcctac
gccggcgtgtaccaggccgtcatcgaggactgccgcgccaacggcgcctacgacccctcc
accatgggttcggttccgaacgtcggcctcatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatccccaccacgggcacggtccgcctggtggacgccgcgggc
aacgcggtgctggagcagacggtctccgccggtgacatcttccgcgcctgccagaccaag
gacgcgccgatccgcgactgggtgaagctcgccgtcacccgcgcccgcgccaccggcgac
ccggccgtcttctggctggacgagggccgcgcccacgacgccaacctgatcgccaaggtc
aaggcgtacctgccggagcacgacaccgagggcctggacatccggatcctcgacccggtc
gaggcgaccaagctgtcggtggagcgcatccgccgcggcgagaacaccatctcggtcacc
ggcaacgtgctgcgcgactacctgaccgacctgttcccgatcctggagctgggcaccagc
gccaaaatgctgtcggtcgtcccgctgatggcgggcggcggcctgttcgagaccggcgcc
ggcggctcggccccgaagcacgtgcagcagctggtcaaggaggactacctgcgctgggac
tccctcggcgagttcttcgccctggtgccgtccctggagcagtacgccgaggccaccggc
aacggcaaggccaaggtcctcgccgacaccctcgaccgcgccacggcgaccttcctcaac
gaggacaagtccccgacccgtcgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggccgggcagaccgacgacgcggacctggccaag
gccttcgccccgctcgccgagacgctcaccgcgaacgagcagaagatcgtcgaggagctg
aacgccgtccagggcaagccggccgagatcggcggctactaccagcccgacccggccaag
gccgccaaggtcatgcgcccgtcggccacctggaacgaggccctggcgtccctcgcctga

DBGET integrated database retrieval system