KEGG   Streptomyces sp. CCM_MD2014: NI25_04870Help
Entry
NI25_04870        CDS       T04862                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
strd  Streptomyces sp. CCM_MD2014
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AIV32949
UniProt: A0A0N6ZHB5
LinkDB All DBs
Position
1112635..1113702
Genome map
AA seq 355 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPGMHYEAKWDGFRAIVFRDGDEVELGSRTGKPLTRYFPE
LVAAVRERLPERCVVDGEIVIARDGHLDFDALTERIHPADSRVRTLAERTPASLVAFDLL
ALDDESLLDVGLADRRALLVRALGGVTPPVHVAPATDDIEVARQWFEQYEGAGLDGVVAK
PLDLRYRQDERAMFKIKHERTADVVVAGYRFHKSGPVVGSLLLGLYDDRGTLQHVGVCAA
FTMKRRAELVEELEPLRMDDAGGHPWAKWAEEAAHASARLPGAPSRWSGKKDLSWVPLRP
ERVVEVAYDHMENGARFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLAEILGGA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggacctccccgtcatgccgcccgtgaagccgatgctcgccaagtccgtggcgaagatc
ccgccggggatgcactacgaggcgaagtgggacgggtttcgggcgatcgtgttccgcgac
ggggacgaggtggagctggggagtcggaccgggaagccgttgaccaggtatttcccggag
ctggtggctgcggtgcgggagcggctgcccgagcggtgcgtggtggacggggagatcgtg
atcgcgcgggacgggcatctcgacttcgacgcgctgaccgagcggatccatccggcggac
tcccgggtgcggaccctggcggaacgcacgccggcctcgctggtcgccttcgatctgctg
gcgctggacgacgagtccctgctcgacgtggggctggccgaccggcgggcgttgctggtg
cgggcgctgggcggggtgacgccgccggtgcacgtggcaccggcgacggacgacatcgag
gtggcccggcagtggttcgagcagtacgagggcgcggggctcgacggggtcgtcgccaag
ccgctcgacctgcggtaccggcaggacgagcgggccatgttcaagatcaagcacgagcgc
acggcggacgtcgtggtcgccgggtatcgcttccacaagagcgggcccgtggtcggctcg
ctgctgctcggcctgtacgacgaccggggcaccctccagcacgtgggggtgtgcgcggcc
ttcaccatgaagcgccgggccgagctggtggaggagctggagccgctgcgcatggacgat
gcgggcggccatccgtgggcgaagtgggccgaggaggccgcgcacgcgtcggcgaggctg
ccgggcgcgccgagccgctggtcgggcaagaaggacctgtcctgggttcccctgcgtccc
gagcgggtcgtcgaagtggcgtacgaccacatggagaacggggcgcgcttccggcacacg
gcccgtttccgccgctggcgcccggaccggacccccgagagctgcacctacgcgcagttg
gaggagccggtccgctacgacctggcggagatcctgggcggagcctga

DBGET integrated database retrieval system