KEGG   Streptomyces sp. CCM_MD2014: NI25_05905Help
Entry
NI25_05905        CDS       T04862                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:strd00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    NI25_05905
Enzymes [BR:strd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NI25_05905
DNA repair and recombination proteins [BR:strd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     NI25_05905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AIV38525
UniProt: A0A0N6W6F3
LinkDB All DBs
Position
complement(1374290..1375204)
Genome map
AA seq 304 aa AA seqDB search
MRAGRRTVEVHRPDKVLFPAGAGGAEEPKEYTKGDLVDYHRAVAPFMLPHLRGRPLMLER
HPDGIDGPRFMQKNTPEHYPEWIERVEVGKEGGTVCHTVCDDSATLVYLADQAALTLHRW
LSRTAEIDRPDRMVFDLDPAGDDFEAVREAARLLAELLDELKLPSAPMTTGSRGLHVVVP
LDGCQDFDDVRDFARAVADVLAAAHPDRLTTAARKKDRGDRLYLDIQRNAYAQTAVAPFT
VRARPGAPVATPISWDQLDDPGLHARRWTIADAVEQARTRPWAGLTDRARALGPARRRLN
ALHD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggccgggcgccgcaccgtggaggtccaccggccggacaaggtgctgttcccggcc
ggtgcgggcggcgccgaggagccgaaggagtacaccaagggcgatctcgtcgactaccac
cgggccgtcgccccgttcatgctgccccacctgcggggccgccccctgatgctggagcgg
cacccggacgggatcgacggaccgcggttcatgcagaagaacaccccggagcactacccg
gagtggatcgaacgcgtcgaggtcggcaaggagggcggcacggtctgccacaccgtctgc
gacgactccgccaccctcgtctacctcgccgaccaggccgcactcaccctgcaccgctgg
ctgtcccggaccgcggagatcgaccggcccgaccgcatggtcttcgacctcgacccggcc
ggagacgacttcgaggcggtccgggaggcggcccggctgctggcggaactgctcgacgag
ctgaagctgccctcggcgccgatgaccaccggctcccgggggctgcacgtcgtggttccg
ctggacggctgccaggacttcgacgacgtacgcgacttcgcgcgggccgtcgccgacgtc
ctggcagccgcccaccccgaccggctcaccaccgccgcccgcaagaaggaccgcggcgac
cggctctacctcgacatccagcgcaacgcctacgcccagaccgcggtcgcccccttcacc
gtgcgcgcccgccccggcgcccccgtggccacgcccatctcctgggaccagctggacgac
cccggtctgcacgcccggcgctggaccatcgcggacgccgtggaacaggcccggaccagg
ccctgggccgggctcacggaccgcgcccgggccctcggccccgcccggcggcggctgaac
gccttgcacgactga

DBGET integrated database retrieval system