KEGG   Streptomyces sp. CCM_MD2014: NI25_06260Help
Entry
NI25_06260        CDS       T04862                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00250  Alanine, aspartate and glutamate metabolism
strd00410  beta-Alanine metabolism
strd00640  Propanoate metabolism
strd00650  Butanoate metabolism
strd01100  Metabolic pathways
strd01120  Microbial metabolism in diverse environments
Module
strd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NI25_06260
   00650 Butanoate metabolism
    NI25_06260
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NI25_06260
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NI25_06260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:strd01007]
    NI25_06260
Enzymes [BR:strd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NI25_06260
Amino acid related enzymes [BR:strd01007]
 Aminotransferase (transaminase)
  Class III
   NI25_06260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIV33181
UniProt: A0A0N6ZGA6
LinkDB All DBs
Position
complement(1464087..1465370)
Genome map
AA seq 427 aa AA seqDB search
MTRDLYARHRAVLPDWLALYYEDPLEITHGEGRHVWDAAGNKYLDFFGGILTTMTAHALP
EVTKAVAEQAGRIVHSSTLYLNRPMVELAERVAQLSGIPDARVFFTTSGTEANDTALLLA
TAHRRSNAILAMRNSYHGRSFSAVGITGNRGWSPTSLSPLQTLYVHGGVRTRGPYAHLDD
RDFIDACVADLEDLLGHTRAPAALIAEPVQGVGGFTSPPDGLYAAFREVLHERGILWISD
EVQTGWGRTGEHFWGWQAHGRSGPPDIVTFAKGIGNGMSIGGVVARAEIMNCLDANSIST
FGGTQVTMAAGLANLAYLLEHDLQGNARRVGGLLIERLRAVAAQVPHVREVRGRGLMIGV
ELTRPGTDEAAPEAATTVLEEARAGGLLVGKGGGHSTSVLRIAPPMSLTVAEAEEGAAIL
ERALRSI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcgacctctacgcccgccaccgcgccgtcctgcccgactggctcgccctctac
tacgaggacccgctggagatcacccacggcgagggccgccacgtgtgggacgcggccggc
aacaagtacctcgacttcttcggcggcatcctcaccacgatgaccgcgcacgccctgccc
gaggtcaccaaggccgtcgccgaacaggccggacggatcgtccactcctcgaccctctac
ctcaaccgcccgatggtggagctcgccgaacgcgtcgcccagctctccggcatccccgac
gcccgcgtcttcttcaccacctcgggcaccgaggccaacgacaccgccctgctgctggcc
accgcccaccggcgcagcaacgcgatcctggcgatgcgcaacagctaccacggccgctcc
ttcagcgccgtcggcatcaccggcaaccgcggctggtccccgacctccctctccccgctc
cagaccctctacgtccacggcggcgtccgcacccgcggaccctacgcccacctggacgac
cgggacttcatcgacgcctgcgtcgccgacctcgaggacctgctcggccacacccgcgcc
cccgccgcactgatcgccgaacccgtccagggcgtcggcggcttcacctccccgcccgac
ggcctgtacgccgccttccgcgaggtgctgcacgagcggggcatcctgtggatctccgac
gaggtgcagaccggctggggccgcaccggcgagcacttctggggctggcaggcacacggc
aggagcgggccgcccgacatcgtgactttcgccaagggcatcggcaacggcatgtcgatc
ggcggtgtcgtcgcccgcgccgagatcatgaactgcctggacgccaacagcatctccacc
ttcggcggcacccaggtcaccatggccgcgggcctcgccaacctcgcgtacctgctggaa
cacgacctccagggcaacgcccggcgcgtcggcggcctgctcatcgaacggctgcgcgcc
gtcgccgcccaggtgccgcacgtacgggaggtgcgcggccgcggtctgatgatcggcgtc
gaactgacccggcccggcaccgacgaggccgcacccgaggccgcgaccaccgtgctggag
gaggcccgcgccggcgggctgctcgtcggcaagggtggcggccacagcaccagcgtcctg
cgcatcgccccgccgatgtccctcaccgtcgcggaggccgaggagggcgccgcgatcctc
gaacgcgccctgcggagcatctga

DBGET integrated database retrieval system