KEGG   Streptomyces sp. CCM_MD2014: NI25_09770
Entry
NI25_09770        CDS       T04862                                 

Definition
(GenBank) fatty acyl-AMP ligase
  KO
K21792  polyketide synthase
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00333  Prodigiosin biosynthesis
strd01100  Metabolic pathways
strd01110  Biosynthesis of secondary metabolites
Module
strd_M00838  Undecylprodigiosin biosynthesis, L-proline => undecylprodigiosin
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NI25_09770
SSDB
Motif
Pfam: AMP-binding ketoacyl-synt Acyl_transf_1 Aminotran_1_2 Ketoacyl-synt_C PP-binding KAsynt_C_assoc Cys_Met_Meta_PP Thiolase_N Aminotran_5
Other DBs
NCBI-ProteinID: AIV33744
UniProt: A0A0N6ZGH7
LinkDB
Position
complement(2273641..2280564)
AA seq 2307 aa
MEKNVSQGPTEPIRAHWQGPEPETVTALLRHRAEHTPDALAHRFLIDGDGTSVAWTYREL
DLHAREVAAHLRREQVGQGPVLLLHPPGLDYLAAFFGCLYAGAVAVPAYPPDNARFGQTV
PRLAAIARDSAATHALTTGKVREAVAARGTGHVGAELDDVRWLVTEDLYTGDSTAPWEDP
GLTADSLAFLQYTSGSTAAPKGVMVEHGNLVRNLRSIHLRLGHDAGSGMVSWLPPYHDMG
LIGGILTPVYGGFPAHLMAPMTFVQRPLLWLETLSRTGASTSVAPNFGFEQCLRRISPEQ
RAGLDLSRWRLALNGAEPIRPDTLDRFAEYFAPAGFDRTALLPCYGLAEATLMVTGAEPA
EPPVVESFDAAALEAGTARRADPGSVRTTRVVGCGAPVDDVEVALVDAATGHRVPDGTVA
EIRVTGPNVARGYWKRPGAGADVFGTRVEDGPDTAWLRTGDLGFRHDGQLFVVGRTKDVI
IVQGRNIHPQDVEQTAERVGAGLRAGHGAAFGIPTEDGEQLALAYEIGGPGAGDPHALLA
RLRTAIADEHQVTPHTVVLLRRSSVPRTTSGKIQRSACRQQLLDLELPVVAASVVQDGTL
PDATGPRLSGPGAPERTAALVADALAASHAAEGAPRYSRLLTAVRTLADGLGVALDVGTL
LSGPEPDGADALTALCRTALADATPAPAPGRTRTEAVTWLRRAVAARLGLRPSVIDPTVP
FTSLGLDSKQAVSLADRFGDWLGTPVTPATVYDHPTVESLAAHVTADATRGAGSRTPAPG
TDAAPHPRPRGTARRTPADEPVAVVGIGCRFPGAPDADSYWRLLRDGRDAVGEAPADRAA
DVAGPGGRPGGFLDDVYDFDARFFGISAREAERMDPQQRLLLEVAWQTLEDAGIAPSSLA
GSDTGVFVGVSGHDYADLQMPHPDVVDMYSATGNAQSVAAGRLSYFFDLRGPSLALDTAC
SSSLAAVHTALRSLRDGECGIALAGGVNLMLAPGLSAALARGGMLGPGGRCRTFDDGADG
YVRGEGAGLVCLKPLSAALADGDRVHAVLTGSALGHGGRANGLTAPRTTAQRAVMTGALE
RAGVEPGQIDFVEAHGTGTALGDPVEWEALAGVYGRGRPADAPCPVGSVKTGIGHLEAAA
GIAGLIKAVLVVRHREVPPLLHLETPNRHLDWTGSGLTVPTTRRALPAEGTLRAGVSSFG
FGGTNAHVIVESAPEPQAPADASETPDGTVHALALSAHTETALTTLAGLYRTHLAAHPDV
PLAALCRSASTGRSPLPHRAVLTAGTRDELDAALDALIRREPAVDVARGEPAPGGAPTVA
FLFGGQGTQYPGMGRDLYDAHPVFARTLRRADAVLRDLGEIPLLGLLFDPEHAEDLARTR
YCQPALVALEVALADLWESCGVRPAAVLGHSVGALAAACVAGVLSLEDALTLAVVRGRAM
DEQPGEGAMIACVGDPETVRDIAAGHEEVALAAVNGPRNLVLSGAADRVAALRADLERKG
VTVRPLVVSHAFHSPLMAGAAEPLRKAARAVEFHAPRIPWISDATGEPVERVDAEYWVRH
LLGTVRFAEGFARLRDRDTEGGLFCDAFVEIGPHPTLLNLGRAAVADAPAGDGRPTLWLP
SLRRGAPGRRTLLRSLGAHHCAGGSVDWSALDGEHPPARVPLPHTPFERRTYRFHAPTPD
QEGDPMPSQPTATSTAETDPAGEVSRTVLDAVAAVCGFPVADLPVHARLGLDLGFDSLMR
TDLQRRLTDRFPQRMHTLQDVPEDPTVQDIIGRLSAGDDRDATPAAGAGTGASAPPAAPP
AAVPAAPHAPAPQYGPYGAFPAPPHGYAVAAPVPQPGVPYPYPYGYPPHGAPAYAYYVPQ
PFPQQAFPFPSPTPPAPVQTPPAPVPTPPAPAQAAPTPAPASAAPAPASAAAPVRQEHTF
EDWAEYAELQGRLRQTRTSGSNPYGRTHEGFNSALATVDGTKVVNFAAFNYLALSHHPRV
RQAAKDAVDRYGTSASATPLLFGETPLHHELEAEIARFIGAEAAIVFSGGHATNVATVGH
LFGPEDLVVHDAWIHDSTVRGCILSGARRRSFPHNDWAALDRILAGARASHRRALVVIEG
AYSQDGDIPDLPRFIEVKKRHGAMLMIDEAHSIGVLGRTGRGVGEHYGTDPADVDLWMGT
LSKALGSLGGYIAARRPIIEYLKFTAPLHIFSTGISPANAAAALEALRVVQDEPERVARV
QELAEFFRAGARARGLDVGVSRLSAVIPVITGDWEKTMALSNSLLERGVNVMPIGYPAVP
RDQCRLRFFINADHSEADLEHSLDLLV
NT seq 6924 nt   +upstreamnt  +downstreamnt
atggagaagaacgtgagtcaggggccgacggagccgatacgcgcgcactggcagggaccc
gaaccggagaccgtcaccgccctgctgcggcaccgggcggagcacaccccggacgccctc
gcccaccgcttcctcatcgacggcgacggcacctccgtcgcctggacctaccgcgaactc
gacctgcacgcccgcgaggtggccgcccacctgcgccgcgagcaggtgggccagggcccc
gtcctgctgctgcacccgccgggcctcgactacctcgccgcgttcttcggctgcctgtac
gccggtgcggtggccgtccccgcctacccgccggacaacgcccggttcgggcagacggtg
ccccgcctcgccgccatcgcccgggactccgccgccacccacgccctcaccaccggcaag
gtccgcgaggcggtcgccgcccgcggcaccggacacgtcggcgccgaactcgacgacgtg
cgctggctggtgaccgaggacctctacaccggcgactccaccgccccctgggaggacccc
ggcctcacggcggactccctggccttcctccagtacacctccggctccacggccgcgccc
aagggcgtgatggtcgagcacggcaacctggtgcgcaacctgcgctccatccacctcagg
ctcggccacgacgccggctccggcatggtgtcctggctgccgccgtaccacgacatgggc
ctcatcggcggcatcctcaccccggtgtacggcggcttccccgcgcatctgatggccccg
atgaccttcgtgcagcgcccgctgctgtggctggagaccctctcccgcaccggcgcctcc
accagcgtcgcgccgaacttcggcttcgagcagtgcctgcgccggatcagccccgaacag
cgggccggcctggacctcagccgctggcgcctcgccctgaacggggccgagccgatccgc
cccgacaccctcgaccggttcgccgagtacttcgcaccggccggcttcgaccgcaccgcg
ctgctgccctgctacggcctcgcggaggcgaccctcatggtcaccggcgccgaaccggcc
gagccacccgtggtggagtccttcgacgcggcggccctggaggcgggcaccgcacgccgg
gcggatccgggcagcgtacgcaccacccgcgtcgtcggctgcggagcacccgtcgacgac
gtcgaggtcgcgctggtcgacgccgccaccggccaccgggtccccgacggcaccgtcgcc
gagatccgggtgaccggaccgaacgtcgcccgcggctactggaagcgccccggggccggc
gcggacgtcttcggcacccgcgtcgaggacggacccgacaccgcgtggctgcgcaccgga
gacctcgggttccgccacgacggccagctcttcgtcgtcggcaggaccaaggacgtgatc
atcgtccagggccgcaacatccatccgcaggacgtggagcagacggccgagcgcgtcggc
gccggtctgcgcgccgggcacggggccgcgttcggcatccccaccgaggacggcgaacaa
ctggcgctcgcctacgagatcggcgggcccggcgccggggacccgcacgccctgctggcc
cgtctgcgcaccgccatcgccgacgagcaccaggtgactccgcacaccgtcgtgctgctc
aggcgctcctcggtgccgcgcaccaccagcggcaagatccagcgcagcgcctgccgtcag
caactgctcgacctcgaactgcccgtggtggccgcgagcgtcgtccaggacggcacactc
cccgacgccaccgggccgcgcctttcgggccccggcgcaccggagcgcacggccgccctc
gtcgccgacgccctcgccgcctcgcacgccgccgagggggccccgcgctactcacggctg
ctgacggccgtacgcacactggccgacggcctcggcgtcgccctggacgtcggcacgctc
ctgtccggccccgaaccggacggcgccgacgccctgaccgcactgtgccggacggccctg
gccgacgccacgccggcacccgcgccgggccggacccggacggaggccgtgacctggctg
cggcgcgccgtcgccgcccggctgggcctgcgcccctcggtgatcgacccgaccgtgccc
ttcacctccctgggcctggactccaagcaggcggtgtccctcgccgaccggttcggcgac
tggctcggcacccccgtcacgccggccaccgtctacgaccacccgaccgtcgagtccctg
gcggcgcacgtcaccgccgacgcgacgaggggcgccgggagccgcaccccggcccccggc
accgacgccgccccgcacccgcgtccgcgcggcaccgcccgccgcacccccgccgacgag
cccgtcgccgtggtcggcatcggctgccgcttccccggcgcccccgacgccgacagctac
tggcggctgctgcgggacggccgggacgccgtgggcgaggcccccgccgaccgggcggcc
gacgtcgcgggtcccggcgggcgcccgggcggcttcctggacgacgtctacgacttcgac
gcccgcttcttcggcatctccgcccgcgaggccgaacgcatggacccccagcagcggctg
ctcctggaggtcgcctggcagaccctggaggacgcgggcatcgctccctcctccctggcg
ggctcggacacgggcgtcttcgtcggggtcagcgggcacgactacgccgacctccagatg
ccccaccccgacgtcgtcgacatgtactcggccaccggcaacgcccagtccgtcgcggcg
ggccggctctcctacttcttcgacctgcgcgggccgagcctcgccctcgacaccgcctgc
tcgtcctcgctcgccgccgtccacaccgccctgcgcagcctgcgggacggcgagtgcggt
atcgccctcgccggcggcgtcaacctgatgctggccccgggcctttcggcggcgctcgcc
cggggcgggatgctcggccccggcggacgctgccgcaccttcgacgacggcgccgacggc
tatgtgcgcggcgagggcgcgggcctggtgtgcctcaaaccgctgtccgccgcactggcc
gacggcgaccgcgtgcacgccgtgctcaccggctccgcgctcggccacggcggccgggcc
aacggcctgaccgcgccccgcaccaccgcccagcgcgccgtgatgaccggggcgctggag
cgggccggggtcgaacccgggcagatcgacttcgtcgaggcgcacggcaccggcaccgcc
ctgggcgaccccgtcgaatgggaggcgctggccggtgtctacggccggggccgccccgcc
gacgcgccctgcccggtcggctccgtcaagaccggcatcggccacctggaggcggccgcg
ggcatcgccgggctgatcaaggcggtgctcgtggtacggcaccgggaggtaccgccgctg
ctgcacctggaaacccccaaccggcacctggactggacgggttcgggcctgaccgtgccc
accacccgcagggccctgcccgccgagggcaccctgcgcgccggcgtcagctccttcggc
ttcggcggcaccaacgcccacgtgatcgtcgagtccgcgcccgaaccccaggcccccgcc
gacgcgtccgagacccccgacggcacggtgcacgccctggccctgtccgcgcacaccgag
accgccctgaccaccctggccggcctctaccgcacccacctcgccgcccaccccgacgtg
ccgctcgccgccctgtgccgctccgccagcaccggccgctccccgctgccgcaccgcgcg
gtcctcaccgccgggaccagggacgaactggacgccgcgctggacgcgctgatccgtcgc
gagcccgccgtcgacgtggcccgcggcgaacccgcgcccggcggcgcacccaccgtcgcc
ttcctcttcggcggccagggcacccagtacccgggcatgggccgcgacctgtacgacgcc
caccccgtgttcgcccgcaccctgcggcgcgccgacgcggtcctgcgcgacctgggcgag
atcccgctgctcggcctgctcttcgacccggagcacgccgaggacctggcccgcacccgc
tactgccagcccgccctggtcgccctcgaagtcgccctcgcggacctgtgggagagctgc
ggagtgcgcccggccgccgtgctcgggcacagcgtcggcgcgctcgccgccgcctgcgtc
gccggcgtcctctctctggaggacgccctcacgctcgcggtcgtccgcgggcgcgccatg
gacgagcagcccggcgagggcgcgatgatcgcctgcgtcggcgacccggagacggtgcgc
gacatcgccgccggccacgaggaggtggcgctcgccgcggtcaacgggccccgcaacctg
gtgctctccggcgcggccgaccgggtcgcggcgctccgtgccgacctggagcgcaagggg
gtcaccgtccggccgctcgtcgtctcgcacgccttccactcaccgctgatggcgggcgcc
gctgagccgctgcgcaaggccgcccgcgccgtcgagttccacgccccgcgcatcccctgg
atctccgacgccaccggcgaaccggtggagcgggtggacgcggagtactgggtccggcac
ctgctcggcaccgtgcgcttcgccgagggcttcgcccgcctgcgcgaccgggacacggag
ggcggtctgttctgcgacgccttcgtcgagatcggcccgcacccgaccctgctgaacctg
ggccgggccgccgtcgccgacgccccggcgggcgacgggcgcccgacgctgtggctgccc
tcgctgcgccgcggcgcccccggccggcgcaccctgctccggtcgctgggcgcccaccac
tgcgccggcgggagcgtggactggtccgccctggacggcgagcacccgcccgcccgcgtc
ccgctgccgcacacgcccttcgagcgccggacctaccggttccacgctcccactcccgac
caggaaggcgatcccatgccgtcccagcccacggcgacgagcacagccgagacggacccg
gcgggcgaggtctcccgcaccgtgctcgacgccgtcgcagccgtctgcggattccccgtg
gccgacctgccggtgcacgcccggctgggtctcgacctggggttcgactcgctgatgcgg
accgacctccagcgccgtctcaccgaccgcttcccccaacggatgcacacgctccaggac
gtgccggaggaccccacggtgcaggacatcatcggccggctctccgcgggcgacgaccgc
gacgccacccctgccgccggtgccggcaccggcgcgagcgcgccgccggccgcccctcca
gcggccgtacctgcggcgccgcacgccccggcaccccagtacggcccctacggcgccttc
ccggccccgccgcacggctacgccgtcgccgctcccgtcccgcagccgggggtgccgtac
ccgtacccgtacggctacccgccgcacggcgcccccgcgtacgcctactacgtcccccag
ccgttcccgcagcaggcgttcccgttcccctccccgacgccgcccgccccggtccagacg
ccgcccgccccggtcccgacgccgcccgccccggcccaggcggcccccaccccggcgccc
gcgtccgccgcccccgcgccggcgtccgccgccgcccccgtccgccaggagcacaccttc
gaggactgggcggagtacgccgaactccagggcaggctccggcagacccggaccagcggc
tccaacccctacggccgcacccacgagggcttcaactccgcgctcgccacggtcgacggc
accaaggtcgtcaacttcgccgccttcaactacctcgcgctctcccaccacccccgggtg
cgccaggccgccaaggacgccgtggaccgctacggcacctcggcctccgccaccccgctg
ctgttcggcgagaccccgctgcaccacgaactcgaagccgagatcgcccggttcatcggt
gccgaggcggccatcgtgttctccggcggccacgccaccaacgtcgccaccgtcggccac
ctgttcggcccggaggacctggtggtgcacgacgcgtggatccacgacagcaccgtgcgc
ggctgcatcctctccggcgcccggcgccggtccttcccgcacaacgactgggccgccctg
gaccgcatcctggccggcgcccgggcctcgcaccgccgggcgctggtcgtcatcgagggc
gcctacagccaggacggcgacattcccgacctgccgcgcttcatcgaggtcaagaagcgg
cacggcgcgatgctgatgatcgacgaggcgcactccatcggcgtcctgggccgcaccggc
cgcggcgtgggcgagcactacggcaccgacccggccgacgtcgacctgtggatgggcacc
ctcagcaaggcgctgggcagcctcggcggctacatcgcggcccgccgcccgatcatcgag
tacctcaagttcaccgcgccgctgcacatcttctccaccggcatctccccggccaacgcc
gccgccgcgctggaggcgctgcgcgtcgtccaggacgagccggaacgcgtcgcacgcgtc
caggaactcgccgagttcttccgggccggcgcccgcgcccgcggcctcgacgtcggagtc
tcccgcctctccgccgtgatccccgtgatcaccggcgactgggagaagacgatggcgctc
tccaactcgctgctggagcgcggcgtcaacgtcatgccgatcggctaccccgccgtcccg
cgcgaccagtgccggctccgcttcttcatcaacgcggaccacagcgaagcagacctcgaa
cactccctcgacctcctggtgtga

DBGET integrated database retrieval system