KEGG   Streptomyces sp. CCM_MD2014: NI25_12645Help
Entry
NI25_12645        CDS       T04862                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:strd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    NI25_12645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:strd03400]
    NI25_12645
Enzymes [BR:strd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NI25_12645
DNA repair and recombination proteins [BR:strd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     NI25_12645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AIV34230
UniProt: A0A0N6ZIU4
LinkDB All DBs
Position
2947451..2948332
Genome map
AA seq 293 aa AA seqDB search
MAPMTEVEGRRVALSNLDKVLYPAAGLTKGELLHYYATTAPVLLPHLRDRPVSFLRYPDG
PDGQVFFTKNVPPGTPDWVTTAEVPRSEGPARMVLVQDLASLMWAANLVTEFHTHQWTAD
DPGEADRLVFDLDPGAPATVVQCCEVALWLRERLAADGVEAYAKTSGAKGLHLLAGVRGS
SSERVSEYAKALAVEAERALPKLVVHRMTRSLRPGKVFVDWSQNAARKTTAAPYTVRARD
VPAVSTPVTWEEVAGCGRAEQFVFRPGDVGPRVEDFGDLLAPLFDRRRAAKLP
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgatgacggaagtggaggggcggcgggtggccctcagcaacctggacaaggtg
ctgtatcccgcggccggcctcaccaagggcgagctgctgcactactacgcgacgaccgcc
ccggtgctgctgccgcacctgcgcgaccgtccggtctccttcctgcggtacccggacggc
ccggacggccaggtgttcttcaccaagaacgtgccgccgggtacgcccgactgggtcacc
acggccgaggtgccccgctcggagggcccggcgcggatggtgctggtgcaggacctggcg
agcctgatgtgggcggcgaacctggtgaccgagttccacacccatcagtggaccgcggac
gatcccggggaggccgaccggctggtgttcgacctggaccccggagcgcccgcgaccgtg
gtgcagtgctgcgaggtggcgctgtggctgcgggagcggctggcggcggacggtgtcgag
gcgtacgccaagacctcgggggccaaggggctgcacctgctggcaggggtgcgggggtcg
tcctcggagcgggtgtcggagtacgcgaaggcgctggcggtggaggcggaacgggcgctg
ccgaagctggtggtacaccggatgacgcgcagcctgcggccggggaaggtgttcgtggac
tggagccagaacgcggcccgcaagaccacggccgccccctacaccgtgcgggcccgcgac
gtgccggccgtgtccaccccggtgacgtgggaggaggtcgccgggtgcgggcgggcggag
cagttcgtgttccggccgggagacgtcggaccgcgggtggaggacttcggggacctgctg
gcgccgctgttcgaccggcggcgggcggcgaagctgccctga

DBGET integrated database retrieval system