KEGG   Streptomyces sp. CCM_MD2014: NI25_12910Help
Entry
NI25_12910        CDS       T04862                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
strd  Streptomyces sp. CCM_MD2014
Brite
KEGG Orthology (KO) [BR:strd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NI25_12910
Enzymes [BR:strd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NI25_12910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: AIV34276
UniProt: A0A0N6ZHS1
LinkDB All DBs
Position
3012946..3013341
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVTVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtcacggtcagcgcccactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggcggagtcggtgaaggccgtccaggag
aagatggccggcaacgacgacccgcacttccagacgcgcgccacggtcatcaaggagcag
cgcgccgagctcgcgaagcaccacgtctccgtgctgtggagcgactacttcaagcccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctgaaggccctgtcg
gccgccaagggctcgaaggacccggcgaccggtcagaaggccctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system