KEGG   Streptomyces sp. CCM_MD2014: NI25_23155Help
Entry
NI25_23155        CDS       T04862                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00620  Pyruvate metabolism
strd00680  Methane metabolism
strd01100  Metabolic pathways
strd01120  Microbial metabolism in diverse environments
strd01200  Carbon metabolism
Module
strd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NI25_23155
  09102 Energy metabolism
   00680 Methane metabolism
    NI25_23155
Enzymes [BR:strd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NI25_23155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIV36015
UniProt: A0A0N6W5Q2
LinkDB All DBs
Position
5186151..5188886
Genome map
AA seq 911 aa AA seqDB search
MSSADDQTTTTTSSELRADIRRLGDLLGETLVRQEGPELLELVEKVRRLTREDGEAAAEL
LRGTELETAAKLVRAFSTYFHLANVTEQVHRGRELGAKRAAEGGLLARTADRLKDADPEH
LRETVRNLNVRPVFTAHPTEAARRSVLNKLRRIAALLDTPVNESDRRRLDTRLAENIDLV
WQTDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLTAELERAGVKLPDDTRPLTFG
TWIGGDRDGNPNVTPQVTWDVLILQHEHGINDALEMIDELRGFLSNSIRYAGATEELLTS
LQADIERLPEISPRYKRLNAEEPYRLKATCIRQKLENTKQRLAKGTPHEEGRDYLGTAQL
IDDLRTVQTSLREHRGGLFADGRLARTIRTLAAFGLQLATMDVREHADAHHHALGQLFDR
LGEESWRYADMPREYRTKLLAKELRSRRPLAPTPAPVDAPGEKTLGVFQTVRRALEVFGP
EVIESYIISMCQGADDVFAATVLAREAGLIDLHAGWAKIGIVPLLETTEELKAADTILED
LLSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRL
FHGRGGTVGRGGGPTHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPALARENLELTVAA
TLQASALHTAPRQSDEALARWDAAMDVVSDAAHTAYRKLVEDPDLPAYFLASTPVDQLAD
LHLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWYGVGSGLKALREAGLDTVLDE
MHQQWHFFRNFISNVEMTLAKTDLRIAQHYVDTLVPDELKHVFDRIKAEHELTVAEVLRV
TGESELLDADPVLKQTFTIRDAYLDPISYLQVALLGRQREAAAANAEPDPLLARALLLTV
NGVAAGLRNTG
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagaccaccacgacgaccagcagcgagctgcgcgccgacatc
cgccgactgggtgatctcctcggcgagaccctcgtccggcaggaaggccccgaactgctg
gaactcgtcgagaaggtacgccgactcacccgcgaggacggcgaggccgccgccgaactg
ctgcgcggcaccgaactggagaccgccgccaagctcgtccgcgccttctccacctacttc
cacctcgccaacgtcaccgaacaggtccaccgcggccgcgaactgggcgccaagcgcgcc
gccgaaggcggactgctcgcccgtaccgccgaccggctcaaggacgccgaccccgagcac
ctgcgcgagacggtccgcaacctcaacgtgcgccccgtcttcaccgcccaccccaccgag
gccgcccgccgctccgtcctcaacaagctgcgccgcatcgcggccctcctggacaccccc
gtcaacgagagcgaccggcgccgcctcgacacccgcctcgccgagaacatcgacctcgtc
tggcagaccgacgaactgcgcgtcgtccgccccgagcccgccgacgaggcccgcaacgcc
atctactacctcgacgaactccacgccggcgccgtcggcgacgtcctcgaggacctgacg
gcggaactggagcgcgcgggcgtcaagctccccgacgacacccgccccctcaccttcggc
acctggatcggcggcgaccgcgacggcaaccccaacgtcaccccccaggtgacctgggac
gtcctcatcctccagcacgaacacggcatcaacgacgccctggagatgatcgacgaactg
cgcggcttcctctccaactccatccgctacgcgggcgccaccgaggaactgctgacctcc
ctccaggccgacatcgaacggctccccgagatcagcccccgctacaagcgcctcaacgcc
gaggagccctaccggctcaaggccacctgcatccggcagaagctggagaacaccaagcag
cgcctcgccaagggcaccccccacgaagagggccgcgactacctcggcaccgcccagctc
atcgacgacctgcgcaccgtccagacctcgctgcgcgagcaccgcggcggcctcttcgcc
gacggccgcctcgcccgcaccatccgcacgctggccgccttcggcctccagctcgccacc
atggacgtccgcgaacacgccgacgcccaccaccacgccctcggccagctcttcgaccgg
ctcggcgaggaatcctggcgctacgccgacatgccccgcgagtaccgcaccaagctcctc
gccaaggaactgcgctcccgcaggccgctcgcccccaccccggcccccgtcgacgccccc
ggcgagaagaccctcggcgtcttccagaccgtccgccgcgccctggaggtcttcggaccc
gaggtcatcgagtcctacatcatctccatgtgccagggcgccgacgacgtcttcgccgcg
accgtgctcgcccgcgaggccggactcatcgacctgcacgccggctgggccaagatcggc
atcgtccccctcctggagaccaccgaggaactcaaggccgccgacaccatcctcgaagac
ctcctctccgacccctcctaccggcgcctggtcgccctgcgcggcgacgtccaggaggtc
atgctcggctactccgactcctccaagttcggcggcatcaccaccagccagtgggagatc
caccgcgcccagcgccgcctgcgcgacgtcgcccaccgctacggcgtacgcctgcgcctc
ttccacggccgcggcggcaccgtcggccgcggcggcggccccacccacgacgccatcctc
gcccagccctggggcaccctggagggcgagatcaaggtcaccgaacagggcgaggtcatc
tccgacaagtacctcatcccggccctggcccgggagaacctggaactgaccgtcgcggcc
accctccaggcctccgccctgcacaccgcgccccgccagtccgacgaggcgctggcccgc
tgggacgccgccatggacgtcgtctccgacgccgcccacaccgcctaccgcaagctcgtc
gaggaccccgacctgccggcctacttcctggcctccacgccggtcgaccagctcgccgac
ctgcacctgggctcccggccctcccgccgccccggctccggcgtctccctcgacggactg
cgcgccatcccgtgggtgttcggctggacccagtcccgccagatcgtccccggctggtac
ggcgtcggctccggcctcaaggccctgcgcgaggccggcctcgacaccgtcctggacgag
atgcaccagcagtggcacttcttccgcaacttcatctccaacgtcgagatgaccctcgcc
aagaccgacctgcgcatcgcccagcactacgtcgacaccctcgtccccgacgagctcaag
cacgtcttcgaccggatcaaggccgagcacgagctcaccgtcgccgaggtcctgcgcgtc
accggcgagagtgaactgctggacgccgacccggtcctcaagcagaccttcaccatccgc
gacgcctacctcgaccccatctcctacctccaggtcgccctcctgggccgccagcgcgaa
gcggccgccgccaacgccgaaccggaccccctcctcgcccgagccctcctcctcacggtc
aacggcgtagcggccggcctgcgcaacaccggctga

DBGET integrated database retrieval system