KEGG   Streptomyces sp. CCM_MD2014: NI25_34165Help
Entry
NI25_34165        CDS       T04862                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00250  Alanine, aspartate and glutamate metabolism
strd00410  beta-Alanine metabolism
strd00640  Propanoate metabolism
strd00650  Butanoate metabolism
strd01100  Metabolic pathways
strd01120  Microbial metabolism in diverse environments
Module
strd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NI25_34165
   00650 Butanoate metabolism
    NI25_34165
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NI25_34165
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NI25_34165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:strd01007]
    NI25_34165
Enzymes [BR:strd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NI25_34165
Amino acid related enzymes [BR:strd01007]
 Aminotransferase (transaminase)
  Class III
   NI25_34165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIV37945
UniProt: A0A0N6W695
LinkDB All DBs
Position
7677249..7678517
Genome map
AA seq 422 aa AA seqDB search
MTALSPHLRQATPVVAVRGEGVHIEGEDGRRYLDFTAGIGVTSTGHCHPRVVAAAQEQVA
TLVHGQYTTVMHPPLRRLVDKLGEVLPQSLDSLFFTNSGSEAVEAALRLARQATGRPNVL
VCHGGFHGRTVAAASMTTSGTRFRSGFSPLMSGVVVTPFPTAYRYGWDEETATRFALREL
DYTLQTISSPADTAAVIVEPVLGEGGYVPANRAFVEGLRERADRHGFLLILDEVQTGVGR
TGRFWGHEHFGVTPDILVTAKGLASGFPLSGIAAPEELMRKAWAGSQGGTYGANAVACAA
ACATLDVVRDEKLVENAETMGARLRHGLEAVASRNPAVGDVRGMGLMLASEFVTADGEPD
PKTAARVQRAAVDEGLLLLLCGAWNQVVRMIPALVIDETAVDEGLRAWAAAVEAGTSGAA
GR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcactgtcgccgcaccttcgccaggccacccccgtggtggcggtccggggcgag
ggggtccacatcgagggcgaggacggccgccgctatctggacttcaccgccggcatcggc
gtcaccagcaccggccactgccacccccgggtcgtggccgccgcccaggagcaggtcgcc
accctggtccacgggcagtacaccaccgtcatgcacccgccgctgcggcgcctggtcgac
aagctcggcgaggtgctgccccaaagcctggacagtctcttcttcaccaactccggcagc
gaggcggtcgaggccgcgctgcgcctggcccgccaggccaccggccggcccaacgtgctg
gtctgccacggcggtttccacggccgtacggtggccgccgcctcgatgaccacctccggc
acccgcttcaggtccggcttctcaccgctgatgagcggcgtggtcgtcacccccttcccg
accgcctaccggtacggctgggacgaggagacggccacccgcttcgccctcagggagctc
gactacaccctccagacgatctcctcgcccgccgacaccgccgccgtcatcgtggaaccg
gtcctgggcgagggcgggtacgtgcccgcgaaccgcgccttcgtcgaaggcctgcgcgag
cgcgccgaccggcacggcttcctgctgatcctggacgaggtgcagaccggcgtgggccgc
accggccggttctggggccacgagcacttcggcgtcacgccggacatcctggtcaccgcc
aagggactggccagcggcttcccgctgtccggcatcgccgcccccgaggagctgatgcgc
aaggcctgggcgggctcgcagggcgggacgtacggcgccaacgcggtcgcgtgcgcggcg
gcctgcgccaccctggacgtcgtacgcgacgagaagctcgtcgagaacgccgagacgatg
ggcgcccggctgcgccacggcctggaggcggtggcgtcgcggaacccggccgtcggcgac
gtacggggcatgggactgatgctggccagcgagttcgtcaccgccgacggcgagccggac
ccgaagaccgcggcccgggtgcagcgggccgccgtcgacgagggactgctcctgctgctg
tgcggggcgtggaaccaggtggtgcgcatgatcccggccctggtgatcgacgagacggcc
gtcgacgagggcctgcgggcgtgggccgccgccgtcgaggccggtacgtcgggagcggcg
ggacgatga

DBGET integrated database retrieval system