KEGG   Streptomyces sp. CCM_MD2014: NI25_34220Help
Entry
NI25_34220        CDS       T04862                                 

Definition
(GenBank) neuramidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00511  Other glycan degradation
strd00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    NI25_34220
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NI25_34220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:strd02042]
    NI25_34220
Enzymes [BR:strd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     NI25_34220
Bacterial toxins [BR:strd02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   NI25_34220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR BNR_3 NPCBM_assoc Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: AIV37956
UniProt: A0A0N6ZSD3
LinkDB All DBs
Position
7695536..7697020
Genome map
AA seq 494 aa AA seqDB search
MQRRVTLAVGTAALAVLGATVPAAHGADSPRKAAAAAGTLTSQDLATAGTGSPYYRIPAL
TRTTKGTLIAAYDARPTLGDLPSNIGVVLRRSTDGGTTWQAQQVVRKDAAPKGYGDPSLL
VDRETGRIFLFYAASVNQGFFGSATGNDESDPNVLQADYSYSDDDGLTWKHERITADIKD
PSWAGMFASSGEGIQLRHGRYKGRLVQQYAIRKDGANYAVSAYSDDHGATWRMGTPVGPG
GDENKTVELSDGRIMLNNRSKPYRTVAYSTDGGVTYTPFQQDTELPDPANNGSVTRFAPD
VDASHPRASWLVFSNTATTDSRSNLTVRLSCDNGQTWPVRKTVESGAAAYSTLTPLGDGT
GPNPGMGLLWERGNVDHITYSSFDLQWLGGVCAPVTVTPPASLPAGRTTSVTVRVVSQND
VRLPAGRVWLDLPDGWSAPAVDVPALDPGQGADMKIPVTVPANATAGDVRTTATYEVRGR
QHSYGDTTFTVTQP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagagtcactctggccgtcggcaccgccgccctggccgtcctgggcgccacc
gtccccgccgcccacggcgccgactccccccgcaaggccgccgcggccgccggaaccctc
acctcgcaggacctcgccaccgccggcaccggctccccctactaccgcatccccgccctg
acccggaccaccaagggcaccctcatcgccgcctacgacgcgcgccccaccctcggcgac
ctgccgagcaacatcggcgtcgtcctcaggcgcagcaccgacggcggcaccacctggcag
gcccagcaggtcgtccgcaaggacgccgcccccaagggctacggcgaccccagcctcctc
gtcgaccgcgagaccggccgcatcttcctcttctacgcggcctccgtgaaccagggcttc
ttcggctcggccaccggaaacgacgagagcgaccccaacgtcctccaggccgactacagc
tactccgacgacgacgggctcacctggaagcacgagcggatcaccgccgacatcaaggac
ccctcctgggccggcatgttcgcctcctccggcgagggcatccagctgcgccacggcagg
tacaagggccggctcgtccagcagtacgccatccgcaaggacggcgccaactacgcggtg
agcgcctacagcgacgaccacggcgccacctggaggatgggcacccccgtcggccccggc
ggagacgagaacaagaccgtcgagctgtccgacggccgcatcatgctcaacaaccgctcc
aagccgtaccgcacggtcgcctactccaccgacggcggcgtcacctacacccccttccag
caggacaccgagctgccggacccggccaacaacggctccgtcacccgcttcgcgccggac
gtggacgcctcgcacccccgcgcctcgtggctcgtgttcagcaacaccgcgacgaccgac
agccgcagcaacctcaccgtccgcctgtcctgcgacaacggacagacctggccggtgcgc
aagaccgtcgagtccggcgccgccgcctactcgaccctcaccccgctcggcgacggcacg
ggacccaacccgggcatgggcctgctgtgggagcggggcaacgtcgaccacatcacctac
tcctccttcgacctccagtggctcggcggggtctgcgcgccggtcaccgtcaccccgccc
gcctccctgcccgcgggacggaccaccagcgtcaccgtccgcgtcgtcagccagaacgac
gtccggctccccgccggccgggtctggctcgacctgccggacggctggagcgccccggcg
gtcgacgtgcccgcgctcgaccccggccagggcgccgacatgaagatccccgtcacggtc
cccgcgaacgccaccgcgggcgacgtgcggacgaccgcgacctacgaggtccgcggtcgc
cagcactcctacggcgacacgacgttcaccgtcacccagccgtag

DBGET integrated database retrieval system