KEGG   Streptomyces sp. 769: GZL_01249Help
Entry
GZL_01249         CDS       T03587                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
stre  Streptomyces sp. 769
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AJC53851
UniProt: A0A0A8EIK3
LinkDB All DBs
Position
1361431..1362492
Genome map
AA seq 353 aa AA seqDB search
MDLPVMPPVSPMLAKSVAKIPAGMQYEAKWDGFRVIVFRDGDEVEIASRTTKSLSRYFPE
VLAAARAELPPRCVLDGEIVIAHDGRLHFEELLERIHPADSRVRTLAARTPASLVAFDLL
ALDSASLLDEPQAARREALVEAVRPARAPVHLAPATTDRELAQRWFAQFEGAGLDGVIAK
PPDLPYRPGERVMYKVKHARTADCVVAGYRLHKSGPVVGSLLLGLHDDAGHLQHVGVCAS
FPMARRRALVEELAPLRMDDATGHPWGAWADEAAHAGRRMPGGPSRWSGGKDLSWVPLRP
ERVCEVGYDHMEGSRFRHTAQFRHWRPDRTPESCTYAQLEEPVGYDLGELLGD
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtgatgcccccggtctcccccatgctcgccaagtcggtggcgaagatc
cccgccggtatgcagtacgaggccaagtgggacggcttccgcgtcatcgtgttccgggac
ggcgacgaggtcgagatcgccagccgcaccaccaagtcgctcagccgctacttccccgag
gtgctggccgcggcacgggccgaactcccgccgcgctgcgtgctggacggcgagatcgtc
atcgcgcacgacggccggctgcacttcgaggaactgctggagcgcatccacccggccgat
tcccgggtgcggacgctggccgcccgcacgcccgcctcgctggtcgccttcgacctgctg
gcgctggactccgcttcgctgctggacgaaccgcaggcggcccgccgggaagccctggta
gaggcggtgcggccggcccgggcgccggtgcacctcgcgcccgccaccaccgaccgggag
ctggcgcagcggtggttcgcgcagttcgagggggccgggctggacggggtgatcgccaaa
ccgccggacctgccgtaccggccgggcgagcgggtgatgtacaaggtcaagcacgcccgg
accgccgactgcgtggtcgcgggctaccggctgcacaagagcgggccggtggtcggctcg
ctgctgctcggactgcacgacgacgccgggcacctccagcacgtcggggtgtgcgcgtcg
ttccccatggcccggcggcgcgccctggtcgaggagctggcgccgctgcggatggacgac
gccaccgggcacccctggggcgcgtgggccgacgaggcggcgcacgccggccgccggatg
ccgggcgggccgagccgctggagcggcggcaaggacctgtcgtgggtgccgctgcgcccg
gagcgggtgtgcgaggtgggctacgaccacatggagggcagccggttccggcacaccgcg
cagttccgccactggcgtcccgaccgcacgccggagagttgcacctacgcgcagttggag
gagccggtcggctacgacctgggcgaactgctcggcgactga

DBGET integrated database retrieval system