KEGG   Streptomyces sp. 769: GZL_01926Help
Entry
GZL_01926         CDS       T03587                                 

Definition
(GenBank) secreted protein
Organism
stre  Streptomyces sp. 769
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase DUF1513
Motif
Other DBs
NCBI-ProteinID: AJC54520
UniProt: A0A0A8EEB8
LinkDB All DBs
Position
2026123..2027295
Genome map
AA seq 390 aa AA seqDB search
MGEVAGARGGIGRRRFVGAVGAIGAAAAAGAAGVGAPAWAGQRRLRPLFLGTYTSKPGGG
TGIGLAGYDPATGALAAGGVLPGVADPSYLALAPDGRTLYAVDEQEDGAVTAVALRRGGG
GPVVLGARSTGGAGPCHLSVHPGGRWLLSANYLSGSVAVHPIDRRSGALGPRTDLVVHSS
PPPGPGQTGPHAHQIVTAPDGRHVLAVDLGNDTVYTYRLDPRAGTLTQVAHAALRPGAGP
RHLTFHPSGRHAYLANEVDNTVVVCGYHPRSGRLVPGAPQSTGTGPGVSYPAQILVTGDG
RFAFLANRGDNSLTRYAVEAGGARLRLLDTVPVGGDFPRQIAFSPDRRWLFAANQKSGSV
TVFAVDALSGALVRVGEPFAAPMAVCVLPR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggtggcaggggcgcgcggcgggatcgggcggcgacggttcgtcggggccgtc
ggggcgatcggggcagccgcggcggcaggggcggccggggtcggcgctccggcgtgggcc
gggcagcggcgactgcggccgctcttcctggggacgtacacctccaagccggggggcggc
accggcatcgggctggccggttacgacccggcgaccggggcgctcgccgccggcggcgtg
ctcccgggggtcgccgatccctcctacctggcgctggcgccggacggccggacgctctac
gcggtcgacgagcaggaggacggcgcggtgacggcggtcgcgctgcgccggggcggcggc
gggccggtggtgctcggcgcccggtccaccggcggggccgggccgtgccacctgtcggtg
caccccggcggacggtggctgctgagcgccaactacctctccgggagcgtggcggtgcac
ccgatcgaccggcgcagtggcgcactggggccgcgcacggacctggtcgtccacagcagc
ccgccgcccggccccgggcagaccgggccgcacgcgcaccagatcgtcaccgcgccggac
ggccgccatgtgctggccgtggacctcggcaacgacaccgtctacacctaccggctcgac
ccgcgggccgggacgctgacccaggtggcgcacgcggcgctgcggccgggcgccgggccg
cgccatctgaccttccacccgtcgggccgccacgcctatctggcgaacgaggtggacaac
acggtggtggtctgcggctaccacccgcgcagcgggcggctggtgcccggggcgccgcag
tccaccgggaccggtccgggggtcagttatccggcgcagatcctggtcaccggcgacggc
cggttcgccttcctggccaaccgcggtgacaacagcctcacccggtacgccgtggaggcg
ggcggggcccggctgcggctgttggacacggtgccggtgggcggcgatttcccgcggcag
atcgcgttctcgccggatcggcggtggctgttcgccgcgaaccagaagtcggggtcggtg
acggtgttcgcggtggatgccctgagcggggcgctggtgcgggtgggcgagccgttcgcg
gcgccgatggcggtctgcgtcctgccgcgctga

DBGET integrated database retrieval system