KEGG   Streptomyces sp. 769: GZL_03440Help
Entry
GZL_03440         CDS       T03587                                 

Definition
(GenBank) putative superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
stre  Streptomyces sp. 769
Brite
KEGG Orthology (KO) [BR:stre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GZL_03440
Enzymes [BR:stre01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GZL_03440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: AJC56026
UniProt: A0A0A8EPT6
LinkDB All DBs
Position
3688870..3689265
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKYQANEDADFRTRAVLIKEQ
RAELAKHHISVLWSDYFKPPHFEKYPQLHQLVNDTLKALSAAKASNDPKTGTKALELIAE
IDKIFWETKKG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgttcgcccccaaggtcaaggtcagcgcgcactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggccgagtcggtcaaggccgtacaggag
aagtaccaggccaacgaggacgcggacttccgcacccgcgccgtcctgatcaaggagcag
cgggccgagctggccaagcaccacatctcggtgctgtggagcgactacttcaagcccccg
cacttcgagaagtacccgcagctccaccagctggtcaacgacacgctcaaggccctcagc
gcggccaaggcctcgaacgacccgaagacgggcacgaaggccctggagctcatcgccgag
atcgacaagatcttctgggagacgaagaagggctga

DBGET integrated database retrieval system