KEGG   Streptomyces sp. 769: GZL_03714
Entry
GZL_03714         CDS       T03587                                 

Definition
(GenBank) 3 C4-dehydratase-like protein
  KO
K13308  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
stre  Streptomyces sp. 769
Pathway
stre00523  Polyketide sugar unit biosynthesis
stre01100  Metabolic pathways
stre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stre00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    GZL_03714
Enzymes [BR:stre01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     GZL_03714
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AJC56300
UniProt: A0A0A8EJ93
LinkDB
Position
complement(4037659..4038777)
AA seq 372 aa
MNWALDHQWLTNGGPLAREFEQRVAELAGVRYCVSTCNATVALQLLARATDLSGEVIMPS
LTFPATAHAFRWLGLTPVFCDIDPSTGCLDPALVEAAITPRTSAIVPVHLWGRPCAVDEL
AKVAADHGVKLFYDAAHGLGCTSKGRPIGGFGQAEVFSFHATKVVNAFEGGAVVTDDEEL
ASRIRAMHNFGFSQGRVSTEAGINGKMTEAAAAMGLTSLDAFEETVRQNEANYDGYQSEL
ADLAGLKVVAFDPEERNNYHYLIVEVDAAETGVHRDLLGDVLRSENVVCQRYFSPGCHEM
EPYRSERPVTLPHTERLAQKVLALPTGPTVSREDIRRVCDIVRLTVERGHEVTRRANERA
ESTAGGEGKGSK
NT seq 1119 nt   +upstreamnt  +downstreamnt
gtgaactgggcgctggaccaccagtggctgaccaacggcggacccctggcgcgcgaattc
gagcagcgcgtggcggaactggccggggtgcgatactgcgtatcgacctgcaatgcgacc
gtcgccctgcaactcctggcccgcgccacggatttgtccggcgaggtcatcatgccgtcg
ctgaccttccccgcgaccgcgcacgcgttccgctggctgggcctgacgccggtcttctgc
gacatcgacccgagcaccggctgcctggaccccgcactggtcgaagccgcgatcactccc
cggaccagtgcgatcgtcccggtccacctgtggggccgtccgtgcgcggtcgacgagctg
gcgaaggtcgcggccgaccacggcgtgaagctgttctacgacgccgcacacgggctcggc
tgcacctcgaagggccggccgatcggcgggttcgggcaggccgaggtgttcagcttccac
gccacgaaggtggtcaacgcgttcgagggcggcgcggtggtgaccgacgacgaggaactg
gccagtcggatccgcgcgatgcacaacttcgggttctcccaagggcgcgtctccacggag
gcgggcatcaacgggaagatgaccgaagccgccgccgcgatgggcctgacctcactcgac
gccttcgaggaaacggtccgccagaacgaggccaactacgacggctaccagtcggagctg
gccgacctcgccgggctgaaggtcgtcgccttcgaccccgaggagcgcaacaactaccac
tacctgatcgtggaagtcgacgccgcggagaccggcgtccaccgcgacctgctcggcgac
gtgctccggtcggagaacgtggtgtgccagcggtacttctcccccggatgccacgagatg
gagccctaccgctcggagcggccggtcaccctgccgcacaccgagcggctcgcacagaag
gtgctcgccctgcccaccggccccaccgtctcccgcgaggacatccgccgggtctgcgac
atcgtgcggctcaccgtggagcggggacacgaggtgacccgccgggcgaacgagcgggcg
gaatccacggccggcggcgaaggcaaggggagcaaatga

DBGET integrated database retrieval system