KEGG   Streptomyces sp. 769: GZL_04181Help
Entry
GZL_04181         CDS       T03587                                 

Definition
(GenBank) Phosphate transport ATP-binding protein PstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
stre  Streptomyces sp. 769
Pathway
stre02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:stre00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    GZL_04181
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stre02000]
    GZL_04181
Enzymes [BR:stre01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     GZL_04181
Transporters [BR:stre02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    GZL_04181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 RsgA_GTPase AAA_30 AAA_29 AAA_15 AAA_33 Rad17 AAA_16 AAA_18 AAA_23 G-alpha AAA_25 RNA_helicase AAA_28 Adeno_IVa2
Motif
Other DBs
NCBI-ProteinID: AJC56763
UniProt: A0A0A8ELN5
LinkDB All DBs
Position
4526484..4527269
Genome map
AA seq 261 aa AA seqDB search
MIPMAKRIDVSGLNAYYGAHKAIDDISMTIEPRSVTAFIGPSGCGKSTFLRTLNRMHEVT
PGGRVEGKVLLDDENLYGAGVDPVAVRRTVGMVFQRPNPFPTMSIFDNVAAGLRLNGRYR
KSELKDIVERSLKGANLWNEVKDRLNKPGSGLSGGQQQRLCIARAIAVEPQVLLMDEPCS
ALDPISTLAIEDLIGELKERFTIVIVTHNMQQAARVSDRTAFFNLAAVGKPGKLIEIDET
ERIFSNPSVQATEDYISGRFG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgatccccatggccaagcgaatcgacgtcagcggcctgaacgcgtactacggtgcccac
aaggccatcgacgacatctccatgaccatcgagccccgctcggtgaccgccttcatcggc
ccctccggctgcggcaagtcgaccttcctgcgcaccctgaaccggatgcacgaggtcacc
cccggcggccgcgtcgagggcaaggtgctgctggacgacgagaacctctacggcgccggc
gtcgacccggtcgccgtccgccgcaccgtcggcatggtcttccagcgccccaacccgttc
ccgacgatgtcgatcttcgacaacgtcgcggccggcctccgcctcaacggcaggtaccgc
aagagcgagctgaaggacatcgtcgagcgctccctcaagggcgccaacctctggaacgag
gtcaaggaccgcctgaacaagcccggctcgggcctgtccggcggccagcagcagcggctg
tgcatcgcccgcgccatcgcggtcgagccgcaggtgctgctgatggacgagccctgctcg
gcgctcgacccgatctccaccctcgccatcgaggacctgatcggggagctcaaggagcgc
ttcacgatcgtcatcgtgacgcacaacatgcagcaggccgcgcgcgtctcggaccgcacg
gctttcttcaacctcgcggccgtcggcaagcccggcaagctcatcgagatcgacgagacc
gagcggatcttctccaacccctcggtccaggccacggaggactacatctccggccgcttc
ggctag

DBGET integrated database retrieval system