KEGG   Streptomyces sp. 769: GZL_04204Help
Entry
GZL_04204         CDS       T03587                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
stre  Streptomyces sp. 769
Pathway
stre00330  Arginine and proline metabolism
stre01100  Metabolic pathways
stre01110  Biosynthesis of secondary metabolites
stre01130  Biosynthesis of antibiotics
stre01230  Biosynthesis of amino acids
Module
stre_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:stre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    GZL_04204
Enzymes [BR:stre01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     GZL_04204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 PDH Shikimate_DH ApbA NAD_Gly3P_dh_N IlvN GFO_IDH_MocA 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AJC56784
UniProt: A0A0A8ELU1
LinkDB All DBs
Position
complement(4554096..4554902)
Genome map
AA seq 268 aa AA seqDB search
MAQKVAVLGTGKIGEALLSGMIRGGWAPCDLLVTARRQERAEQLRTRYGVEAVSNAEAAK
AADTLILTVKPQDMGTLLTELAPHVPADRLVISGAAGIPTSFFEERLAPDTPVVRVMTNT
PALVDEAMSVISAGTHATAAHLTLAEEIFSTVGKTLRVPESQQDAATALSGSGPAYFYFL
VEAMTDAGILLGLPRDKAHDLIVQAAIGAAVMLRDSGEHPVKLRENVTSPAGTTINAIRE
LENHGVRAALIAALEAARDRSRELANGN
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcccagaaggtcgccgtactcggcaccggaaaaatcggcgaagccctgctcagcggc
atgatccgcggcggctgggcgccctgcgacctgttggtcaccgcccgccgccaggagcgc
gccgaacagctccgcacccgctacggcgtcgaggcggtcagcaacgccgaggccgccaag
gccgccgacaccctgatcctcaccgtcaagccccaggacatgggcaccctgctgaccgag
ctggccccgcacgtccccgccgaccgcctggtgatcagcggcgccgccggcatcccgacc
tccttcttcgaggagcggctggcccccgacaccccggtcgtccgggtcatgacgaacacc
cccgccctcgtcgacgaggcgatgtccgtcatctccgccggcacccacgccaccgccgcg
cacctcaccctcgcagaggagatcttctccacggtcggcaagaccctgcgcgtcccggag
tcccagcaggacgccgccaccgccctctccggctccggcccggcctacttctacttcctc
gtcgaggcgatgaccgacgccggcatcctcctcggcctgccccgcgacaaggcccacgac
ctgatcgtccaggctgctatcggtgccgcggtgatgctccgcgacagcggcgaacacccg
gtcaagctccgcgagaacgtcacctcccccgcgggcaccaccatcaacgccatccgcgaa
ctggagaaccacggcgtgcgcgccgccctgatcgccgccctggaggcagcccgcgaccgc
agccgcgaactggccaacggcaactga

DBGET integrated database retrieval system