KEGG   Streptomyces sp. 769: GZL_04848Help
Entry
GZL_04848         CDS       T03587                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
stre  Streptomyces sp. 769
Pathway
stre00380  Tryptophan metabolism
stre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    GZL_04848
Enzymes [BR:stre01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     GZL_04848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AJC57426
UniProt: A0A0A8ETS2
LinkDB All DBs
Position
5221256..5222629
Genome map
AA seq 457 aa AA seqDB search
MSESRETPKSPGPAAAGARKAAIRAAELDAAGPLTTTRERFVLDDTVYLDGNSLGALPRA
VPDRIAEVIRHEWGELRIRSWTEAGWWTAPERIGDRIAPLVGAAPGQVVVGDSTSINVFK
AVTGGIRMAGKGCTEILVDATTFPTDGYIARSAARMAGLAVRPVEPARIADEVTERTALA
LVNHVDYRTGELNDMASITAALHSAGTLAVWDLCHSAGALPVALDACGVDLAVGCTYKYL
NGGPGSPAYLYVRKSLQERFESPLPGWNSHVDPFGMEPGYTPADGVLRGRVGTPDILSML
ALEAALEAWEGVAIEDVRAKSLALTDFFLECVSEYAPPGRVRSVTPYEHRRRGSQVSLAC
SPGGSSAAAQGGAPVAGEVMAELIRRGVVGDFRPPDVLRFGFTPLYTTFADAERAAWVLG
EVLREQAAAESASGSESASGSESAGAGQESAADGDAG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagagccgtgagaccccgaagagccccggcccggccgctgccggggcgcgcaag
gcggcgatccgcgccgccgaactggacgccgccgggccgctgaccacgacccgcgagagg
ttcgtcctcgacgacaccgtctatctcgacggcaactcgctcggcgcgctgccccgggcg
gtgcccgaccggatcgccgaggtgatccgccacgagtggggcgagctgcgcatccgctcc
tggaccgaggccggttggtggaccgcgcccgagcggatcggcgacaggatcgccccgctc
gtcggggcggccccgggccaggtggtggtcggcgactccaccagcatcaacgtcttcaag
gcggtgaccggcggaatccggatggccggcaagggctgcacggagatcctggtcgacgcc
acgaccttccccaccgacggctatatcgcccgctccgcggcccggatggccggcctcgcg
gtgcggccggtcgagcccgcgcggatcgccgacgaggtcaccgagcggaccgcgctggcg
ctggtcaaccacgtcgactaccgcaccggcgagctcaacgacatggcctcgatcaccgcc
gcgctgcacagtgcgggcacgctggcggtctgggacctgtgccacagcgccggtgcgctg
ccggtcgcgctggacgcgtgcggggtggacctcgcggtgggctgcacctacaagtacctc
aacggcggcccgggttcgcccgcgtacctctacgtccgcaagagcctccaggagcggttc
gagtcgccgctgcccggctggaactcgcacgtcgacccgttcgggatggagccgggctac
accccggccgacggcgtcctgcgcggtcgcgtcggcacccccgacatcctctcgatgctg
gccctggaggcggcgttggaggcgtgggagggcgtcgccatcgaggacgtgcgcgccaag
agcctggcgctgaccgacttcttcctggagtgcgtgtcggagtacgcgccgcccggccgg
gtccgctcggtcaccccgtacgagcaccggaggcgcggcagccaggtctcgctggcgtgc
tcccccgggggctcctccgcggccgcgcaggggggtgcccccgtggccggtgaggtgatg
gcggagctgatccggcgcggtgtggtcggcgacttccggccgccggacgtgctgcgcttc
ggcttcaccccgctctacaccaccttcgcggacgcggagcgggcggcgtgggtgctcggc
gaggtgctgcgggagcaggccgcggcggagtcggcgtcagggtcggagtcggcgtcgggg
tcggagtcggccggcgcggggcaggagtccgcggcggacggcgacgccgggtga

DBGET integrated database retrieval system