KEGG   Streptomyces sp. 769: GZL_09073Help
Entry
GZL_09073         CDS       T03587                                 

Definition
(GenBank) zinc-containing alcohol dehydrogenase
Organism
stre  Streptomyces sp. 769
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AJC61596
UniProt: A0A0A8F519
LinkDB All DBs
Position
complement(9648724..9649722)
Genome map
AA seq 332 aa AA seqDB search
MRAVVVHTPGHHEVTTVADPTPGPGEVVIAPAAVGICGTDAHIVDGEFAPTPYPIIPGHE
FTGEVLALGTGVTGLRIGEQVAVDPSLFCGACHFCAIGRGNLCENWGAIGDTVDGAMAEY
VKVPAANCYRLPENIEVSQGTLIEPLSCAVRGFDVLPRRLGDHYLIYGAGTMGLMMLQLA
RTAGAASLSVVDLNTDRLRVAEHLGADATAVSAAQLDRPQGWETVIDCTGAIPVIEDGLT
RVRRGGTFQQFGVAPSAAAASFSPFKVYNDEITIVGSMAVLHSFGRAVDLMAKGVIDADT
MITHRYPLEDFGTALQTFRQGTGRKIQICPQA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgtcgtcgtccacactcccgggcaccacgaggtcaccaccgtcgccgatccc
accccgggcccgggcgaggtcgtcatagcccccgccgccgtcggcatctgcggcaccgac
gcacacatcgtcgacggggaattcgcccccaccccctacccgatcatccccggccacgaa
ttcaccggcgaagtcctcgcgctgggcaccggcgtcaccggcctgcgcataggcgaacag
gtcgccgtcgacccctccctgttctgcggcgcctgccacttctgcgccatcggccgcggc
aacctctgcgagaactggggcgccatcggggacaccgtggacggcgccatggccgagtac
gtcaaagtaccggcagccaactgctaccgcctgcccgaaaacatcgaagtctcccagggc
actctgatcgagccgctgtcctgcgcggtgcgcggcttcgacgtgcttccccgccgcctg
ggcgaccactacctcatctacggcgccggcaccatgggcctgatgatgcttcagctcgcc
cgaaccgccggcgcggcatccctgtcggtcgtcgacctcaacactgaccgcctgcgggtc
gccgaacacctcggcgcggacgccacggcggtcagcgccgcacagctggaccgcccgcag
ggatgggagaccgtcatcgactgcaccggcgccatccccgtcatcgaggacggcctcacc
cgggtccgccgcggtggcaccttccaacagttcggcgtcgcaccgtccgcagccgcggcg
tccttctccccgttcaaggtctacaacgacgagatcaccatcgtcggctcgatggccgtc
ctgcacagcttcggccgcgccgtcgacctcatggcgaagggcgtcatcgacgccgacacc
atgatcacccaccgctaccccctggaggacttcggcaccgccctccagaccttccgccag
ggcaccggccgcaagatccaaatctgcccgcaagcctga

DBGET integrated database retrieval system