KEGG   Streptomyces sp. 4F: ASR50_09690Help
Entry
ASR50_09690       CDS       T04265                                 

Definition
(GenBank) MIP family channel protein
  KO
K02440  glycerol uptake facilitator protein
Organism
strf  Streptomyces sp. 4F
Brite
KEGG Orthology (KO) [BR:strf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:strf02000]
    ASR50_09690
Transporters [BR:strf02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    ASR50_09690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: ALV49652
UniProt: A0A0U3RA89
LinkDB All DBs
Position
2180203..2181105
Genome map
AA seq 300 aa AA seqDB search
MADRVTAPRRRGYREGIGGEMLAEFLGTFVLILLGIGSVAVALVGLPGSGRQFVDFGPAN
WLIICWGWGFGVIFGVYVAGGISGAHLNPAVTLAFTVRRDFPLKKLPAYWLAQLLGAFVA
AALVYACYHWAIDAADAKAGLARDESLGTYSIFATFPAEYFGDSWWGPLLDQIVGTGILL
LLICALIDMKNVAPLANLHPFLIGLVVVAIGMTFGTNAGYAINPARDFGPRLFTYFEGWG
DIALPGTFGWFSGYWWIPIVGPLIGAVVGVLVYDLIIKPVVTARTRAMEAQEEGPATEEV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcgcgttacagctccgcgccgacgcggctatcgcgaaggcataggcggcgag
atgctcgccgaattcctggggacgttcgtcctcattctgctgggtatcggatccgtcgcc
gtcgcactcgtgggtctgcccggttccgggcgccagttcgtggacttcggcccggcgaac
tggctcatcatctgctggggctggggcttcggcgtcatcttcggcgtctacgtcgcgggc
ggcatcagcggcgcccacctcaacccggcggtgaccctggccttcaccgtgcgcagggat
ttccccctgaagaagttgccggcctactggctggcgcagcttctcggtgccttcgtcgcc
gccgcgctcgtctacgcctgctaccactgggcgatcgatgccgccgacgcgaaggcgggt
ctggcccgtgacgaatcactgggcacctattccatcttcgcgaccttccccgcggaatac
ttcggggattcatggtggggaccgctgctcgaccagatcgtgggcaccggaattctgctg
ctcctgatctgcgcgctcatcgacatgaagaatgtcgcccccctcgcgaatctccacccg
ttcctcatcggcctggtggtcgtggccatcggtatgacgttcggcacgaacgccggatac
gccatcaaccccgcgcgcgatttcggcccccggctgttcacctacttcgagggctgggga
gacatcgcgttgcctggcacgttcgggtggttcagcggctactggtggatcccgatcgtc
ggcccgctgatcggcgccgtcgtcggcgtgctggtgtacgacctgatcatcaagccggtg
gtcaccgccaggacgcgggcgatggaggcccaggaggaaggcccggccaccgaagaggtg
tga

DBGET integrated database retrieval system