KEGG   Streptomyces sp. 4F: ASR50_10825Help
Entry
ASR50_10825       CDS       T04265                                 

Definition
(GenBank) glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00500  Starch and sucrose metabolism
strf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ASR50_10825
Enzymes [BR:strf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ASR50_10825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: ALV49862
UniProt: A0A0U3HEQ8
LinkDB All DBs
Position
complement(2440487..2441860)
Genome map
AA seq 457 aa AA seqDB search
MARRTLAGIAALAAASAVMTPTVAEASPPGSKDVTAVLFEWNFASVARECTTTLGPAGYG
YVQVSPPAEHIQGSQWWTSYQPVSYKIAGRLGDRTAFKNMVDTCHAAGVKVVADTVINHM
SAGSGTGTGGSSYTKYDYPGLYSSYDFDNCTSEINNYGDRWNVQNCELVGLSDLDTGEEY
VRKTIAGYMNDLLSLGVDGFRIDAAKHIPAADLANIKSRLTNPSAYWKQEVIYGAGEAVQ
PGEYTGTGDVQEFRYAYDLKRVFNNENLAYLKNYGEGWGYLKSGSAGVFVDNHDTERNGS
TLSYKDNANYTLANVFMLAWPYGAPDINSGYEFTDHDAGPPNGGRVDACWQSGWKCQHNW
PEIRSMVGFRNATRGQAVTDWWDNGGDAIAFGRGSKGFVAINHESGSLTRTYQTSLPAGT
YCDVQSNKPVTVDGSGRLTATLGGNTALAVYAGKSSC
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcagaaccctcgccgggatcgccgccctcgcggccgcctcggctgtcatgacc
ccgacagtggctgaggcgtccccgcccggctccaaggacgtcacggccgtcctcttcgaa
tggaacttcgcctccgtcgcccgcgagtgcaccaccaccctcggccccgcgggctacgga
tacgtgcaggtctccccgcccgccgagcacatacaaggttcgcagtggtggacctcgtac
cagccggtgagctacaagatcgccggacgtctgggcgaccgcaccgccttcaagaacatg
gtggacacgtgtcacgcggccggggtgaaggtcgtcgccgacaccgtcatcaaccacatg
tccgccggcagcggcacgggcaccggcggctcgtcgtacacgaagtacgactacccgggc
ctgtactcgtcctacgacttcgacaactgcacgtcggagatcaacaactacggcgaccgc
tggaacgtccagaactgcgaactggtcggcctgtccgacctcgacaccggcgaggagtac
gtccgcaagaccatcgccgggtacatgaacgacctgctctccctcggcgtggacggcttc
cgcatcgacgcggccaagcacatcccggccgccgacctggccaacatcaagtcacgactg
accaacccctccgcctactggaagcaggaggtcatctacggcgccggcgaggccgtccag
cccggcgagtacaccggcaccggagacgtccaggagttccgctacgcctacgacctcaag
cgggtcttcaacaacgagaacctcgcctacctgaagaactacggcgagggctggggctac
ctgaagagcggctccgccggcgtcttcgtcgacaaccacgacaccgagcgcaacggctcc
acgctcagctacaaggacaacgccaactacaccctggccaacgtcttcatgctggcctgg
ccctacggcgccccggacatcaactccggctacgagttcacggaccacgacgccggaccg
cccaacggcgggcgcgtggacgcctgctggcagagcggctggaagtgccagcacaactgg
ccggagatcaggtcgatggtcggcttccgcaacgccacccgcggccaggccgtcaccgac
tggtgggacaacggcggcgacgccatcgccttcggccggggcagcaagggcttcgtggcg
atcaaccacgagtccggctccctgacccgcacctaccagacctccctcccggcaggcacg
tactgcgacgtgcagagcaacaagccggtgacggtggacggttcgggccggctcaccgcg
accctcggcggcaacaccgccctcgcggtgtacgcgggcaagagcagttgctga

DBGET integrated database retrieval system