KEGG   Streptomyces sp. 4F: ASR50_11665Help
Entry
ASR50_11665       CDS       T04265                                 

Definition
(GenBank) aldose epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00010  Glycolysis / Gluconeogenesis
strf00052  Galactose metabolism
strf01100  Metabolic pathways
strf01110  Biosynthesis of secondary metabolites
strf01120  Microbial metabolism in diverse environments
strf01130  Biosynthesis of antibiotics
Module
strf_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:strf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASR50_11665
   00052 Galactose metabolism
    ASR50_11665
Enzymes [BR:strf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     ASR50_11665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim TAT_signal
Motif
Other DBs
NCBI-ProteinID: ALV50009
UniProt: A0A0U3G417
LinkDB All DBs
Position
2625751..2626905
Genome map
AA seq 384 aa AA seqDB search
MELNRRTVIAGAAAAGVATTAWGGTAHASSKGGGRPVRKPFGRLADGTRVDRWTLENGGT
RMGVLSYGGIVHSLEIPDRRGRYANVSLGLRTLEEYVASSPYFGALIGRYGNRIGEGTFT
LDGTRYQLSVNDGDNSLHGGEQGFDKRVWDVEPFTRGSDVGLHLYYTSADGEMGYPGTLR
TKVTYTLTRHGDWRVDYEAVTDRPTVVNLTSHVYWNLAGEGSGGITDHELSIAASRYTPV
DAGLIPTGERAKVAGTPFDFRRAKPVGRDIRTAHQQLLYGQGFDHNWVLDKGVTARPEHA
ATLRDPASGRTLRIATNEPGLQFYSGNFLDGTLVGSGGRVYRQGDGLCLETQHFPDSPNQ
PAFPSTVLRPGETYRTTTVHSFGT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaacagacgcacggtcatcgcgggagccgccgcggccggagtggccaccacg
gcctggggcgggacggcgcacgcctcgtccaagggcgggggcaggccggtacggaagccg
ttcggcaggctcgccgacggcacccgggtggaccgctggacactggagaacggcggcacc
cggatgggggtcctctcctacggcggcatcgtccactcgttggagatccccgaccggcgc
ggccggtacgccaacgtctccctcggcctgcgcaccctggaggagtacgtcgcctccagc
ccgtacttcggggcgctgatcggccggtacggcaaccgcatcggcgaggggaccttcacc
ctcgacggcacccggtaccagctctccgtcaacgacggcgacaacagcctgcacggcggc
gagcagggtttcgacaagcgggtctgggacgtcgagccgttcacccgcggctccgacgtg
ggcctgcacctgtactacacgtccgccgacggggagatgggctacccgggcaccctgcgc
accaaggtgacgtacaccctcacccggcacggcgactggcgcgtcgactacgaggccgtc
accgaccggcccacggtcgtcaacctcaccagccacgtctactggaacctggccggcgag
ggcagcggaggcatcacggaccacgaactgtcgatcgccgcctcccgctacacgccggtc
gacgcgggcctgatccccaccggcgagcgggcgaaggtcgcgggcaccccgttcgacttc
cggcgcgccaagccggtcggccgggacatccgcaccgcccatcagcaactgctgtacggg
cagggtttcgaccacaactgggtgctggacaagggcgtcaccgcccgtccggagcacgcg
gcgaccctgcgtgacccggcctcgggacgcaccctgcgcatcgcgacgaacgagccgggc
ctgcagttctactccggcaacttcctcgacggcaccctcgtcggcagcggcggccgggtg
taccggcagggcgacgggctgtgcctggagacccagcacttcccggactccccgaaccag
ccggcgttcccctcgaccgtgctgcggccgggcgagacgtaccggacgacgacggtgcac
tccttcgggacgtga

DBGET integrated database retrieval system