KEGG   Streptomyces sp. 4F: ASR50_14955Help
Entry
ASR50_14955       CDS       T04265                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00010  Glycolysis / Gluconeogenesis
strf00053  Ascorbate and aldarate metabolism
strf00071  Fatty acid degradation
strf00280  Valine, leucine and isoleucine degradation
strf00310  Lysine degradation
strf00330  Arginine and proline metabolism
strf00340  Histidine metabolism
strf00380  Tryptophan metabolism
strf00410  beta-Alanine metabolism
strf00561  Glycerolipid metabolism
strf00620  Pyruvate metabolism
strf00625  Chloroalkane and chloroalkene degradation
strf00903  Limonene and pinene degradation
strf01100  Metabolic pathways
strf01110  Biosynthesis of secondary metabolites
strf01120  Microbial metabolism in diverse environments
strf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:strf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASR50_14955
   00053 Ascorbate and aldarate metabolism
    ASR50_14955
   00620 Pyruvate metabolism
    ASR50_14955
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ASR50_14955
   00561 Glycerolipid metabolism
    ASR50_14955
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ASR50_14955
   00310 Lysine degradation
    ASR50_14955
   00330 Arginine and proline metabolism
    ASR50_14955
   00340 Histidine metabolism
    ASR50_14955
   00380 Tryptophan metabolism
    ASR50_14955
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ASR50_14955
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ASR50_14955
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ASR50_14955
Enzymes [BR:strf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ASR50_14955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ALV50583
UniProt: A0A0U3GH60
LinkDB All DBs
Position
complement(3386112..3387572)
Genome map
AA seq 486 aa AA seqDB search
MSSYFTDLAQQYIDGEWRPGTGSWDIIDFNPYDDEKLASITIATVDEVDQAYRAAARAQK
EWADTNPYARRAVFEKALRLVEEREEEIAGAIVAELGGTRLKAAFELHLAKEFLRESVHL
ALAPEGRILPSPVDGKENRVYREPVGVVGVISPFNFPFLLSLKSVAPALALGNGVVLKPH
QNTPVVGGSLVAKIFEDAGLPPGLLNVVITDIAEIGDAFLEHPIPKVISFTGSDEVGRHV
ATVCASLFKRAVLELGGNSALVVLDDADVDYAVDAAVFSRYVHQGQVCMAANRILVDRAV
ADEFTEKFVAKVRTLKAGDPRDPETVIGPVINSRQADALTGVVEQALAEGATALVHGGRS
DNLVEPSVVTGLPADSALLRQEVFGPVAFLVPFDGEEEAVRLVNDTPYGLSGAVHTGDVE
RGVRFAKRIDTGMFHVNDGTVHDEPIVPFGGEKHSGVGRLNGDTMLDAFTSTKWISVQHG
RSGFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgtacttcaccgacctggctcagcagtacatcgacggtgagtggcgcccgggc
accggctcctgggacatcatcgacttcaacccgtacgacgacgagaagctcgcgtcgatc
accatcgccacggtcgacgaggtcgaccaggcgtaccgggcggcggcccgcgcgcagaag
gagtgggcggacaccaacccgtacgcccgccgcgcggtgttcgagaaggcgctccggctg
gtcgaggagcgcgaggaggagatcgccggggcgatcgtcgccgagctgggcgggacccgc
ctcaaggccgccttcgagctgcacctcgccaaggagttcctgcgcgagtcggtgcacctg
gcgctcgcccccgagggccggatcctcccctcgccggtggacggcaaggagaaccgcgtc
taccgcgagccggtcggcgtggtcggcgtgatcagcccgttcaacttccccttcctgctg
tcgctgaagtccgtcgcccccgcgctcgcgctgggcaacggcgtggtgctcaagccgcac
cagaacaccccggtcgtcggcggctccctggtcgcgaagatcttcgaggacgcgggactg
ccccccgggctgctcaacgtcgtgatcaccgacatcgcggagataggcgacgccttcctg
gagcacccgataccgaaggtcatctccttcaccggctccgacgaggtcggccggcacgtc
gcgaccgtctgcgcctccctcttcaagcgcgcggtgctggagctgggcggcaacagcgcg
ctggtggtcctggacgacgccgacgtggactacgccgtggacgcggccgtgttcagccgg
tacgtccaccagggccaggtctgcatggccgccaaccgcatcctggtcgaccgggccgtg
gccgacgagttcaccgagaagttcgtcgccaaggtgcgcacgctgaaggccggcgacccc
cgcgacccggagaccgtcatcggcccggtgatcaactcccggcaggcggacgccctcacc
ggcgtcgtcgagcaggccctcgccgagggcgccaccgccctggtgcacggcggacgcagc
gacaacctggtcgagccgtccgtcgtcaccgggctgccggccgactccgccctgctgcgg
caggaggtgttcggcccggtcgcgttcctcgtcccgttcgacggcgaggaggaggcggtg
cgcctggtgaacgacaccccctacgggctcagcggcgccgtgcacaccggggacgtcgag
cggggcgtgcggttcgcgaagcggatcgacaccgggatgttccacgtcaacgacggcacc
gtgcacgacgagccgatcgtccccttcggcggcgagaagcactcgggcgtgggccggctg
aacggcgacaccatgctggacgccttcaccagcaccaagtggatctcggtgcagcacggc
cgcagcggcttcccgttctga

DBGET integrated database retrieval system