KEGG   Streptomyces sp. 4F: ASR50_19635Help
Entry
ASR50_19635       CDS       T04265                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00620  Pyruvate metabolism
strf00680  Methane metabolism
strf01100  Metabolic pathways
strf01120  Microbial metabolism in diverse environments
strf01200  Carbon metabolism
Module
strf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:strf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ASR50_19635
  09102 Energy metabolism
   00680 Methane metabolism
    ASR50_19635
Enzymes [BR:strf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ASR50_19635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALV51400
UniProt: A0A0U3Q9P3
LinkDB All DBs
Position
4379314..4382046
Genome map
AA seq 910 aa AA seqDB search
MSSADDQTTTTSAELRADIRRLGDLLGETLVRQEGPELLDLVEKVRRLTREDGEAAAELL
RGTELETAAKLVRAFSTYFHLANVTEQVHRGRELAARRAAEGGLLSRTADRLKDADPEHL
RQTVRHLNVRPVFTAHPTEAARRSVLNKLRRIAALLETPVLASDRRRLDTRLAENIDLVW
QTDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLTAELERVGVHLPDDTRPLTFGT
WIGGDRDGNPNVTPQVTWDVLILQHEHGINDALEMIDELRGFLSNSIRYTGATEELLTSL
QADLEALPEISPRYKRLNAEEPYRLKATCIRQKLENTKLRLAKGTAHEPGRDYLGTSELI
TDLRIIQESLREHRGGLFADGRLARTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRL
GEESWRYADMPRDYRSKLLAKELRSRRPLAPTPAPVDEAGEKTLGVFRTVKRALEVFGPE
VVESYIISMCQGADDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDELKAADTILEDM
LADPSYRRLVALRCDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLF
HGRGGTVGRGGGPTHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVAAT
LQASALHTAPRQSVEALARWDAAMDVVSDAAHSAYRSFVEDPDLPTYFLASTPVDQLAEL
HLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVLDEM
YGQWHFFRNFISNVEMTLAKTDLRIAQHYVDTLVPDELKHVFDTIKAEHALTVTEVLRVT
GERELLDADPVLKQTFSIRDAYLDPISYLQVALLKRQRDAVAAGDQPDPLLSRALLLTVN
GVAAGLRNTG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagaccaccacgacgagcgccgaactgcgtgccgacatccgc
cgactgggcgacctcctcggagagacgctcgtccggcaggagggcccggagctcctcgac
ctcgtcgagaaggtccgccgcctcacccgcgaggacggcgaggccgccgccgagctgctg
cgcggcaccgagctggagaccgccgccaagctggtgcgcgccttctccacctacttccac
ctggccaacgtcaccgaacaggtgcaccgcggacgcgaactcgccgcccgccgcgccgcc
gagggcggtctgctctcccgaaccgccgaccggctcaaggacgccgaccccgagcacctg
cgccagaccgtacggcacctcaacgtacggcccgtgttcaccgcccaccccaccgaggcg
gcccgccgctccgtcctcaacaagctccgccgcatcgccgccctcctggagacgccggtc
ctcgcctccgaccggcgccgcctcgacacccgtctggcggagaacatcgacctcgtctgg
cagacggacgaactgcgcgtggtgcgccccgagcccgccgacgaggcccgcaacgccatc
tactacctcgacgagctgcacgccggcgccgtcggcgacgtcctggaggacctcaccgcc
gaactggagcgcgtcggcgtccacctccccgacgacacccgcccgctcaccttcggcacc
tggatcggcggcgaccgcgacggcaaccccaacgtcaccccccaggtcacctgggacgtc
ctgatcctccagcacgagcacggcatcaacgacgccctggagatgatcgacgagctgcgc
ggcttcctctccaactccatccgctacaccggagccaccgaggaactgctcacctccctc
caggccgacctggaggcgctgcccgagatcagcccccgctacaagcgcctcaacgccgag
gagccctaccggctcaaggccacctgcatccggcagaagctggagaacaccaagctccgc
ctcgccaagggcaccgcgcacgagcccggccgcgactacctcggcaccagcgagctcatc
accgacctgcggatcatccaggagtccctgcgcgagcaccgcggcggcctcttcgccgac
ggccgcctcgcccgcaccatccgcaccctcgccgccttcggcctccagctcgccaccatg
gacgtccgcgagcacgccgacgcccaccaccacgccctcggccagctgttcgaccggctc
ggcgaggagtcctggcgctacgccgacatgccccgcgactaccgctccaagctcctcgcc
aaggagctgcgctcccgccgcccgctggcacccacccccgcgcccgtcgacgaggccggc
gagaagaccctcggcgtcttccgcaccgtcaagcgcgccctggaggtcttcggccccgag
gtcgtcgagtcgtacatcatctccatgtgccagggcgccgacgacgtgttcgccgccgcc
gtcctcgcccgcgaggccggcctcatcgacctgcacgcgggctgggcgaagatcggcatc
gtgccgctcctcgagacgacggacgagctcaaggccgccgacacgatcctcgaggacatg
ctcgccgacccgtcctaccggcgcctcgtcgccctgcgctgcgacgtccaggaggtcatg
ctcggctactccgactcctccaagttcggcggcatcaccaccagccagtgggagatccac
cgcgcccagcgccgactgcgcgacgtcgcccaccgctacggcgtccgcctgcgcctcttc
cacggccgcggcggcaccgtcggccgcggcggcggccccacccacgacgcgatcctcgcc
cagccctggggcaccctcgagggcgagatcaaggtcaccgagcagggcgaggtcatctcc
gacaagtacctcatcccgtccctcgcccgcgagaacctcgaactgaccgtcgccgccacc
ctccaggcctccgccctgcacaccgcgccccgccagtccgtcgaggccctcgcccgctgg
gacgccgccatggacgtcgtctccgacgccgcccactccgcgtaccggtccttcgtcgag
gaccccgacctgccgacgtacttcctcgcctccaccccggtcgaccagctcgccgagctg
cacctgggctcgcggccctcccgccgccccggctccggcgtctccctcgacggcctgcgc
gccatcccgtgggtgttcggctggacccagtcccggcagatcgtccccggctggttcggc
gtcggctccggcctcaaggcgctgcgcgaggccggcctggacacggtgctcgacgagatg
tacggacagtggcacttcttccgcaacttcatctccaacgtggagatgaccctcgccaag
acggacctgcggatcgcccagcactacgtcgacaccctcgtccccgacgagctcaagcac
gtcttcgacaccatcaaggccgaacacgccctcaccgtcaccgaggtgctgcgcgtcacc
ggcgagcgggaactgctggacgccgaccccgtcctcaagcagaccttctccatccgcgac
gcctacctggacccgatctcctacctccaggtggccctgctcaagcgccagcgcgacgcg
gtcgccgccggggaccagcccgacccgctgctctcccgcgccctgctgctcaccgtcaac
ggcgtcgcggcgggcctgcgcaacaccggctga

DBGET integrated database retrieval system