KEGG   Streptomyces sp. 4F: ASR50_24630Help
Entry
ASR50_24630       CDS       T04265                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00500  Starch and sucrose metabolism
strf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ASR50_24630
Enzymes [BR:strf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ASR50_24630
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     ASR50_24630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ALV52278
UniProt: A0A0U3HLG2
LinkDB All DBs
Position
complement(5468523..5470223)
Genome map
AA seq 566 aa AA seqDB search
MSVNEPVPDTFEDTPAKDRDPDWFKRAVFYEVLVRSFQDSNGDGIGDLKGLTAKLDYLQW
LGVDCLWLPPFFKSPLRDGGYDVADYTAVLPEFGDLADFVEFVDSAHQRGMRVIIDFVMN
HTSDQHPWFQESRRDPDGPYGDYYVWADDDKQFQDARIIFVDTEASNWTYDPVRKQYYWH
RFFSHQPDLNYENPAVQEEMISALKFWLDLGIDGFRLDAVPYLYQREGTNCENLPETHAF
LKRVRKEIDTQYPDTVVLAEANQWPEDVVDYFGDYAAGGDECHMAFHFPVMPRIFMAVRR
ESRYPVSEILAKTPAIPSGCQWGIFLRNHDELTLEMVTDEERDYMWAEYAKDPRMRANIG
IRRRLAPLLDNDRNQIELFNALLLSLPGSPIIYYGDEIGMGDNIWLGDRDAVRTPMQWTP
DRNAGFSSSDPGRLYLPTIMDPVYGYQVTNVEASMASPSSLLHWTRRMIEIRKQNPAFGL
GSYTELPSSNPAVLAFLREYEDDLVLCVNNFSRFAQPTELDLSAFEGRHPVELFGGVRFP
AVGELPYLMTLGGHGFYWFRLRKDAA
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcaacgaacccgtcccggacaccttcgaagacacccccgccaaggaccgggac
cccgactggttcaaacgcgccgtcttctacgaggtcctcgtccgctccttccaggacagc
aacggggacggcatcggtgacctgaagggtctgaccgccaagctggactacctgcagtgg
ctgggcgtcgactgcctgtggctgcctccgttcttcaagtcgccgctgcgcgacggcggg
tacgacgtggccgactacaccgccgtcctgccggagttcggtgacctcgccgacttcgtg
gagttcgtcgactcggcccatcagcgcggcatgcgcgtgatcatcgacttcgtcatgaac
cacaccagcgaccagcacccgtggttccaggagtccaggcgcgaccccgacggtccgtac
ggcgactactacgtgtgggccgacgacgacaagcagttccaggacgcgcgcatcatcttc
gtcgacaccgaggcgtcgaactggacgtacgaccccgtacgcaagcagtactactggcac
cgcttcttctcgcaccagccggacctgaactacgagaacccggccgtgcaggaggagatg
atctcggcgctgaagttctggctggacctcggcatcgacgggttccggctcgacgcggtg
ccgtatctgtaccagcgggaagggacgaactgcgagaacctcccggagacccacgcgttc
ctgaagcgggtccgcaaggagatcgacacgcagtacccggacacggtggtgctggcggag
gcgaaccagtggcccgaggacgtcgtcgactacttcggcgactacgccgccggcggcgac
gaatgccacatggcgttccacttcccggtcatgccccgcatcttcatggcggtacgacgg
gagtcccgctacccggtctccgagatcctcgccaagacccccgccatcccgtcgggctgc
cagtggggcatcttcctgcgcaaccacgacgagctgaccctggaaatggtcaccgacgag
gaacgcgactacatgtgggccgagtacgccaaggacccccgcatgcgcgccaacatcggc
atccgccgccgcctcgcacccctcctcgacaacgaccgcaaccagatcgagctcttcaac
gccctgctgctgtccctgcccggctcgccgatcatctactacggcgacgagatcggcatg
ggcgacaacatctggctcggcgaccgcgacgcggtgcgcacccccatgcagtggaccccc
gaccgcaacgccggcttctcctcctccgaccccggccgcctctacctccccacgatcatg
gacccggtctacggctaccaggtcaccaacgtcgaagcctccatggcctcaccctcgtcg
ctgctccactggacccggcgcatgatcgagatccgcaaacagaaccccgccttcggcctc
ggctcctacaccgagctgccctcctccaaccccgccgtcctcgccttcctccgcgagtac
gaggacgacctcgtcctctgcgtcaacaacttctcccgtttcgcgcagcccacggagctg
gatctcagcgccttcgaggggcggcacccggtggagctgttcggcggggtgcgcttcccg
gcggtcggcgagctgccgtacctgatgacgctcggagggcacggcttctactggttccgg
ctccggaaggacgccgcgtag

DBGET integrated database retrieval system