KEGG   Streptomyces sp. 4F: ASR50_30225Help
Entry
ASR50_30225       CDS       T04265                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
strf  Streptomyces sp. 4F
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: ALV53272
UniProt: A0A0U3QEW9
LinkDB All DBs
Position
complement(6851457..6852524)
Genome map
AA seq 355 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPGMQYEAKWDGFRAIVFRDKDEVELGSRTGKPLTRYFPE
LVEALRERLPERCVVDGEIVIAREGHLDFDALTERIHPADSRVRTLAERTPASFVAFDLL
ALADESLLDVPLTDRRKLLVRALRDVTPPVHVAPATTDVEVAEGWFEQYEGAGLDGVVAK
PLDLRYRQDERAMFKIKHERTADVVVAGYRLHKSGPVVGSLLLGLYDAQGALQHVGVSAA
FTMKRRAELVEELEPLRMEDVSDHPWAAWADEAAHASARLPGAPSRWTGKKDLSWVPLRP
ERVAEVAYDHMENGQRFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLAEILGGP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggacctcccggtgatgccgcccgtcaagccgatgctcgccaagtcggtggcgaagatc
cccccgggcatgcagtacgaggcgaagtgggacggcttccgggcgatcgtgttccgcgac
aaggacgaggtggagctgggcagccgtacgggcaagccgctcacccggtacttccccgag
ctggtggaggcgctgcgggagcggctgcccgagcggtgcgtcgtggacggggagatcgtc
atcgcccgcgaagggcacctggacttcgacgcgctgacggagcgcatccacccggccgac
tcccgggtacggaccctcgccgagcgcacccccgcgtcgttcgtggcgttcgacctgctg
gccctcgcggacgagtcgctgctggacgtgccgctcaccgaccggaggaagctgctggtg
cgggcgctgcgggacgtcaccccgccggtgcacgtggcgccggcgacgacggacgtcgag
gtggcggagggctggttcgagcagtacgagggcgcgggtctggacggggtggtggccaag
ccgctcgacctgcggtaccggcaggacgagcgggccatgttcaagatcaagcacgagcgc
acggcggacgtggtggtcgccgggtaccggctgcacaagagcggcccggtggtgggctca
ctgctgctgggtctgtacgacgcgcagggcgccctccagcacgtgggcgtgtcggccgcg
ttcacgatgaagcggcgcgcggagctggtggaggagctggagccgctgcggatggaggac
gtgtcggaccatccgtgggcggcctgggcggacgaggcggcgcacgcgtcggcgaggctg
ccgggggcgccgagccgctggacgggcaagaaggacctgtcgtgggtgccgctgcggccg
gagcgggtggcggaggtcgcgtacgaccacatggagaacgggcagcgcttccggcacacc
gcccgtttccgccgctggcgccccgaccgcacccccgagagctgcacgtacgcgcagctg
gaggagccggtccgctacgacctcgccgagatcctcggcgggccgtga

DBGET integrated database retrieval system