KEGG   Streptomyces sp. 4F: ASR50_30900Help
Entry
ASR50_30900       CDS       T04265                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00020  Citrate cycle (TCA cycle)
strf00480  Glutathione metabolism
strf01100  Metabolic pathways
strf01110  Biosynthesis of secondary metabolites
strf01120  Microbial metabolism in diverse environments
strf01130  Biosynthesis of antibiotics
strf01200  Carbon metabolism
strf01210  2-Oxocarboxylic acid metabolism
strf01230  Biosynthesis of amino acids
Module
strf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
strf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:strf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASR50_30900
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ASR50_30900
Enzymes [BR:strf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ASR50_30900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALV53390
UniProt: A0A0U3R3K9
LinkDB All DBs
Position
complement(6996574..6998793)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVQAYASQAGVAVETRDISLAGRIIAVFPEYLTEDQ
RIPDALAELGELAKTPAANIVKLPNISASIPQLKAAIAELQGKGYALPDYPDDPKTDEER
DIQARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKNHPHRMGAWTSESKTNVATMGQDD
FRSTEKSVVIAEDGALRIELKGDDGSTTVLRESVPVLKGEVVDASVMRVAALREFLTAQV
ARAKQEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFAKYGDKLAAAGLTPNDGLGGI
YKGLENLPEGAEIKASFDAELTEGPDLAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEADTLAVLPDSSYAGVYQAVIDDCRANGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPVTGTVRLVDANGDAVIEQAVSAGDIFRACQTKDAPIRDWVKLAVTRARATGD
PAVFWLDETRAHDANLIAKVKQYLPEHDTEGLDIRILNPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSFEQYAATTGNAHAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELAAQTEDADLAKAFAPLAETLAANEAKIVEELAAVQGKPAEIGGYYQPDPAK
ASAVMRPSATWNEALASLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacactgacgaggccccggccctggcgacgtat
tccttcctgccggtggtccaggcgtacgcctcgcaggccggtgtcgccgtggagacgcgg
gacatctcgctcgccgggcgcatcatcgccgtgttcccggagtacctcaccgaggaccag
cgcatcccggacgccctcgccgagctcggtgagctggcgaagacgcccgcggccaacatc
gtgaagctgccgaacatctcggcgtcgatcccgcagctcaaggccgcgatcgccgagctg
cagggcaagggctacgcgctgccggactacccggacgacccgaagaccgacgaggagcgg
gacatccaggcccgctacgacaaggtcaagggctcggccgtgaacccggtcctgcgtgag
ggcaattccgaccgccgcgcccccgcctcggtgaagaactacgccaagaaccacccgcac
cgcatgggcgcctggacctccgagtccaagaccaacgtcgccaccatgggccaggacgac
ttccgctccaccgagaagtccgtcgtgatcgccgaggacggcgcgctgcgcatcgagctc
aagggcgacgacggctccacgaccgtgctccgcgagtcggtgccggtcctcaagggcgag
gtcgtcgacgcctccgtgatgcgcgtcgccgcgctgcgcgagttcctcaccgcgcaggtc
gcccgcgccaagcaggagggcgtgctgttctccgtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtggtgcgcgccttcttcccgaagacgttcgcg
aagtacggcgacaagctcgccgccgcgggtctcaccccgaacgacggtctgggcggcatc
tacaagggcctggagaacctgcccgagggcgccgagatcaaggcgtccttcgacgccgag
ctcaccgagggcccggacctggcgatggtcgactccgacaagggcatcacgaacctgcac
gtcccctcggacgtcatcgtggacgcctccatgccggccatgatccgcacctccggccac
atgtggggccccgacggccaggaggccgacaccctcgcggtgctcccggactcctcctac
gcgggcgtctaccaggccgtgatcgacgactgccgcgccaacggcgcctacgacccgtcc
acgatgggctcggtcccgaacgtcggtctgatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatccccgtcaccggcaccgtccgcctggtcgacgccaacggc
gacgccgtcatcgagcaggccgtgtccgccggtgacatcttccgcgcctgccagaccaag
gacgcgccgatccgcgactgggtgaagctggccgtcacccgcgcccgcgccaccggcgac
ccggccgtcttctggctggacgagacccgcgcgcacgacgccaacctgatcgccaaggtg
aagcagtacctgccggagcacgacaccgagggcctggacatccggatcctcaacccggtc
gaggcgaccaagctgtcggtggagcgcatccgccgcggcgagaacaccatctcggtcacc
ggcaacgtgctgcgcgactacctcaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggcgggcggcggcctcttcgagaccggcgcg
ggcggctcggccccgaagcacgtgcagcagctggtcaaggagaactacctgcgctgggac
tccctcggtgagttcttcgccctggtgccgtcgttcgagcagtacgccgccaccaccggc
aacgcgcacgccaaggtgctcgccgacaccctcgaccgcgccacggcgaccttcctcaac
gaggacaagtccccgacccgtcgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggccgcgcagaccgaggacgcggacctcgcgaag
gcgttcgcgccgctcgccgagaccctcgcggccaacgaggcgaagatcgtcgaggagctc
gccgccgtccagggcaagccggccgagatcggcggctactaccagcccgacccggcgaag
gcctccgcggtcatgcgcccgtccgccacgtggaacgaggcgctggcgtccctgagctga

DBGET integrated database retrieval system