KEGG   Streptomyces sp. 4F: ASR50_33200Help
Entry
ASR50_33200       CDS       T04265                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:strf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ASR50_33200
Enzymes [BR:strf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ASR50_33200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Glyco_hydro_35 Glyco_hydro_14 Glyco_hydro_2_C Cellulase
Motif
Other DBs
NCBI-ProteinID: ALV53798
UniProt: A0A0U3HQL5
LinkDB All DBs
Position
complement(7509786..7511828)
Genome map
AA seq 680 aa AA seqDB search
MISTLLSRSGGPDGDTAPRLLFGADYNPEQWPRSVWEEDVRLMREAGVNVVSVGIFSWAR
LQPTADTWDFGWLDDVLDLLHEGGVGVDLATATASPPPWLTTAHPEVLPVTATGETLWPG
ARQHWRPTSPVFRRYALDLVRKIAERYRDHPALVAWHVSNELGCHNVYDYSDDAARAFRE
WLRERYRTLDALNDAWGTAFWSQRYSAWEQILPPRLAASHPNPTQQLDFKRFSSDALKDH
LRAERDLLREITPDVPVTTNFMVMGNTKGMDYADWAEEIDFVSNDHYVHPGPQDRDELSF
SANLTSGIAGGQPWFLMEHSTSAVNWQPVNVAKRPGELARDSLLHVAHGADAVCFFQWRQ
SAAGAEKYHSAMVPHAGADSDLFRAVAELGATLKKLAPVAGSEREPAKVGIVYDWDSWWA
SEQDSHPTALLRYRQEALDWYSALLRLGIRADLVTTRSDLQRHQVLIAPVLHVVPADLAK
TLTRYTEQGGHLITTYFSGVVDEHDHVWLGGYPGALRNLLGITVEEFAPLLAGDSVELDD
ATTGTLWTDRITVTADETDVLVRYRTGEQAGRPAVTRRPSGRGTAAYVSTRLGVDGLASL
LPRLLEPAGVESELPAGARGSVEPVVRRGPGGRFLFLVNRTDGTVPVPGLDGEVLLGDTG
DDGTLTLGPRAVAVLRQPAS
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgatctccaccctcctgtcccgcagcggcgggccggacggtgacaccgccccccgtctc
ctcttcggcgccgactacaacccggagcagtggccccgctccgtgtgggaggaggacgtc
cggctgatgcgggaggccggcgtcaacgtcgtgtccgtcgggatcttctcctgggcccgg
ctccagccgacggcggacacctgggacttcggctggctggacgacgtgctcgacctgctg
cacgagggcggcgtcggcgtcgacctggccaccgcgaccgcctccccgccgccgtggctg
accaccgcccacccggaggtcctcccggtgaccgcgaccggcgagaccctgtggccgggc
gcccgccagcactggcgtcccacctcgcccgtcttccgccggtacgccctggacctggta
cggaagatcgccgagcgctaccgggaccaccccgcgctcgtcgcctggcacgtcagcaac
gagctgggctgccacaacgtctacgactattccgacgacgcggcccgtgcattccgggag
tggctgcgcgagcggtaccgcacgctggacgcgctcaacgacgcctggggcaccgcgttc
tggtcgcagcgctactccgcgtgggagcagatcctgccgccgcgactggccgcctcgcac
cccaacccgacccagcagctggacttcaagcggttctcgtcggacgcgctgaaggaccac
ctgcgcgccgagcgggacctgctgcgggagatcaccccggacgtgccggtcaccaccaac
ttcatggtgatgggcaacaccaagggcatggactacgcggattgggcggaggagatcgac
ttcgtctccaacgaccactacgtgcaccccggcccccaggaccgcgacgagctgtccttc
tccgccaacctcaccagtggcatcgccggcggccaaccgtggttcctgatggagcactcg
accagcgccgtcaactggcagccggtgaacgtggccaagcgccccggcgagctggcgcgc
gactccctgctgcacgtggcgcacggcgcggacgcggtctgcttcttccagtggcggcag
tcggcggcgggcgccgagaagtaccactcggcgatggtgccgcacgccggcgcggacagc
gacctgttccgcgcggtggccgagctgggcgccacgctgaagaagctggccccggtggcg
ggcagcgagcgggagcccgcgaaggtcggcatcgtgtacgactgggactcctggtgggcg
agcgagcaggactcgcaccccacggccctgctgcggtaccggcaggaggccctcgactgg
tactcggcgctgctccgcctcggcatccgtgccgacctcgtcaccacccgctcggacctc
cagcgccaccaggtgctgatcgcgcccgtgctgcacgtggtgcccgccgacctggccaag
acgctcacccggtacaccgaacagggcggccatctgatcacgacgtacttctccggggtc
gtcgacgagcacgaccacgtgtggctcggcggctatccgggcgccctgcggaacctgctg
ggcatcacggtcgaggagttcgcgccgctgctcgcgggcgacagcgtggagctggacgac
gccaccaccggcacgctgtggaccgaccgcatcacggtgaccgccgacgagacggacgtc
ctcgtccgctaccgcaccggcgagcaggccggccggcccgccgtcacccggcgcccctcg
ggccgcggcaccgccgcgtacgtctccacccggctcggtgtggacgggctggcgtcgctg
ctgccgcgtctgctggaaccggccggtgtggagagcgaactgcccgccggggcgcgggga
tcggtggagccggtggtgcgccggggtcccgggggccggttcctgttcctggtgaaccgg
accgacggcaccgtccccgtgccggggctcgacggcgaggtgctgctcggggacaccggc
gacgacgggaccctcaccctcggcccccgggccgtcgcggtcctgcggcagccggcctcc
tga

DBGET integrated database retrieval system