KEGG   Streptacidiphilus sp. DSM 106435: C7M71_003770Help
Entry
C7M71_003770      CDS       T05561                                 

Definition
(GenBank) glycoside hydrolase family 3 protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
stri  Streptacidiphilus sp. DSM 106435
Pathway
stri00520  Amino sugar and nucleotide sugar metabolism
stri01100  Metabolic pathways
stri01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:stri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C7M71_003770
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    C7M71_003770
Enzymes [BR:stri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     C7M71_003770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: AXI76705
UniProt: A0A345SSK0
LinkDB All DBs
Position
846495..848210
Genome map
AA seq 571 aa AA seqDB search
MAQDLDTRVRALLARMCLEDKVGQLFVSRVHGGDTEHPSPAEAAENRKALGVATAAEAVA
RYRLGGVVYFGWTGNLDSPERTAALSAGLQRAARLLPVPVPLLIATDQEQGSVVRIGPPA
TGFPGAMALGASGRPEDARSAARVTGTELAALGINQDYAPVADVNLDPANPVIGTRSFGG
DPSAVAALTAAQVQGFHDAGTVCTAKHFPGHGDTSADSHTGLPVIGHSRAEWERVDLPPF
AAAVRHGVDSVMTAHIVVPALDPSGDPATLSRPIITGLLRRHLGYDGVVVTDSLTMAGVR
TRYGDDRVPVLALKAGADQLLDPPDLALAYRSVLHAVRDGELTESRIDASVTRVLRLKVR
RGLFERRPPDPASVRRLLGTPAHLAVADTVADHSITLLRNDDRVLPLAAAAGRPVLVTGW
EPVGGSAGIGTAAGQPVRELAAALSALGLPTRALPTGPAPDAAAVARATRAAGDTGDTGV
TGDAGGGGAVVVLTGGAAGDAAQRRLVAALLATGRPMVQIAVRDPYDLARLPGVRTALAT
YSWSPASMRAAARVLAGRTTPTGRPPVTLPD
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggacctcgacacccgcgtccgggcactgctcgcccggatgtgccttgaggac
aaggtcggccagctcttcgtcagccgcgtccacggcggcgacaccgagcacccctccccc
gccgaggcagccgagaaccgcaaggccctcggggtcgccaccgccgccgaggcggtggcc
cgctaccggctgggcggcgtcgtctacttcggctggaccggcaacctcgacagccccgag
cgcaccgcggcactctccgccggactccagcgcgccgcccgcctgctccccgtacccgtg
cccctgctgatcgccaccgaccaggagcagggctcggtggtccgcatcggcccaccggcc
accggattccccggcgccatggcgctcggcgcctccggccgcccggaggacgcccgcagc
gccgcccgggtcaccggcacggagttggccgcgctcggcatcaaccaggactacgccccg
gtcgccgacgtcaacctcgaccccgccaacccggtgatcggcacccggtccttcggcgga
gacccgagcgcggtcgccgccctcaccgccgcccaggtgcagggcttccacgacgcgggc
acggtctgcacggccaagcacttccccggccacggggacacctccgccgacagccacacc
ggtctgccggtgatcgggcacagccgggccgagtgggagcgggtggaccttccgccgttc
gccgccgccgtccgacacggggtggactccgtgatgacggcgcatatcgtcgtccccgcg
ctcgacccctccggcgacccggccaccctctcccggccgatcatcaccggcctgctgcgc
cgacacctcggctatgacggcgtggtggtcaccgactccctcaccatggcgggcgtacgg
acccgctacggggacgaccgggtacccgtactcgccctcaaggccggtgccgaccaactg
ctcgatccgcccgacctggcgctcgcctaccggtcggtgctgcatgcggtacgcgacggt
gaactgaccgagagccggatcgacgcctccgtgacccgggtgctgcggctgaaggtgcgg
cgcggactcttcgagcggcggccacccgacccggcctcggtccggcggctgctgggtacg
cccgcgcacctcgcggtggccgacaccgtggccgaccacagcatcacgctgctgcgcaac
gacgatcgcgtcctgccgctcgcggcggcggccgggcggccggtgctggtgaccggctgg
gagccggtcggcggctccgccgggatcggcaccgccgccggacagccggtacgggagctg
gccgccgccctctccgccctcgggctccccacccgggcgctccccaccggcccggccccc
gacgccgcagcggtggcccgcgccacccgggccgccggggacaccggggacaccggggtc
accggggacgcggggggcggcggcgcggtggtggtgctcaccggcggggcggccggagac
gccgcacagcggcggctggtggccgcgctgctggcgacggggcggcccatggtgcagatc
gccgtccgcgacccctacgacctggcccggctgcccggggtacgcaccgccctggccacc
tactcctggtccccggcgtcgatgcgggcggcggcccgggtcctggccggccgtaccacc
cccaccggccgaccgcccgtcaccctccccgactga

DBGET integrated database retrieval system