KEGG   Streptacidiphilus sp. DSM 106435: C7M71_004585Help
Entry
C7M71_004585      CDS       T05561                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
stri  Streptacidiphilus sp. DSM 106435
Pathway
stri00250  Alanine, aspartate and glutamate metabolism
stri00410  beta-Alanine metabolism
stri00430  Taurine and hypotaurine metabolism
stri00650  Butanoate metabolism
stri01100  Metabolic pathways
stri01110  Biosynthesis of secondary metabolites
stri01120  Microbial metabolism in diverse environments
stri02024  Quorum sensing
Module
stri_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:stri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C7M71_004585
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C7M71_004585
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C7M71_004585
   00430 Taurine and hypotaurine metabolism
    C7M71_004585
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C7M71_004585
Enzymes [BR:stri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     C7M71_004585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AXI76842
UniProt: A0A345SSY7
LinkDB All DBs
Position
1053130..1054536
Genome map
AA seq 468 aa AA seqDB search
MALHKGRDDDRRLAVNPFLGETDPVGSMAVAPPLHRLPDGPMTPSAAYRLIHDELLLDGN
ARLNLATFVTTWMEPQAATLMSECFDKNMVDKDEYPQTAELERRCVAILADLWHAPDPAQ
AVGCSTTGSSEACMLAGLALKRRWMHRNADRYAAGARPNLVMGINVQVCWEKFCAYWEVE
PRLAPMEGERYHLDAEQAVRLCDENTIGVVGVLGSTFDGSYEPVQDICAALDDLQQRTGL
DVPVHVDGASGAMVAPFLDEELVWDFRLPRVASINTSGHKYGLVFPGVGWALWRDQEALP
EELVFRVNYLGGDMPTFALNFSRPGSEVVAQYYTFLRLGRDGYRAVQQASRDVAGRLADG
IEALGCFRLLTRGDQLPVFAFTTADDVTAFDVFDVSRRLRERGWLVPAYAFPEHRADLSV
LRIVCRNGFSQDLADLLLTDLGRLVEELHHQPKPLQQLGVEPRTAFHH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctgcacaagggccgggacgacgaccggcgactcgccgtcaaccccttcctcggg
gagaccgacccggtgggctccatggcggtcgctccgccgctgcaccggcttccggacggg
cccatgacgccgtccgccgcctaccgcctgatccatgacgaactgctgctcgacggcaac
gcccggctcaacctggccaccttcgtcaccacctggatggaaccccaggcggccaccctc
atgtccgagtgcttcgacaagaacatggtcgacaaggacgagtacccgcagaccgccgaa
ctggagcggcgctgcgtggccatcctcgccgacctctggcacgcccccgaccccgcccag
gccgtgggctgctccaccaccggctccagcgaagcctgcatgctcgccgggctggcgctc
aaacgccgctggatgcaccgcaacgccgaccggtacgccgccggggcgcggcccaacctg
gtgatgggcatcaatgtgcaggtctgctgggagaagttctgcgcctactgggaggtcgaa
ccccggctcgccccgatggagggcgagcgctaccacctcgacgccgagcaggcggtgcgg
ctctgcgacgagaacaccatcggcgtggtcggcgtgctgggctccaccttcgacggcagc
tatgaaccggtccaggacatctgcgccgccctggacgacctccagcagcgcaccggcctg
gatgtgccggtccatgtcgacggcgcttccggcgcgatggtggcgccgttcctggacgag
gagctggtctgggacttccggctgccgcgcgttgcctccatcaacacctccggccacaag
tacggtctggtttttcctggcgtgggctgggcgctctggcgcgaccaggaggcgctcccc
gaggagctggtcttccgggtgaactacctcggcggcgacatgccgacctttgcgctcaac
ttctcccggcccggctccgaggtggtcgcccagtactacaccttcctgcggctcggccgg
gacggctaccgggccgtgcagcaggcgtcccgggacgtggccgggcggctcgccgacggt
atcgaggcgctgggctgcttccggctgctcacccggggcgaccagctgccggtcttcgcc
ttcaccaccgccgacgatgtcaccgccttcgacgtcttcgatgtgtcgcggcggctgcgc
gagcgcggctggctggtccccgcgtacgccttcccggagcatcgcgcggacctgtcggtg
ctgcgtatcgtctgccgcaacggcttctcgcaggacctcgccgacctgctgctgaccgac
ctcggcagactggtcgaagaactgcaccaccagccgaagccgctccagcagctgggcgtc
gagccccgcacggccttccaccactga

DBGET integrated database retrieval system