KEGG   Streptacidiphilus bronchialis: C7M71_007300
Entry
C7M71_007300      CDS       T05561                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
stri  Streptacidiphilus bronchialis
Pathway
stri00997  Biosynthesis of various secondary metabolites - part 3
stri01100  Metabolic pathways
stri01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stri00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    C7M71_007300
Enzymes [BR:stri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     C7M71_007300
SSDB
Motif
Pfam: DeoC TraB
Other DBs
NCBI-ProteinID: AXI77275
UniProt: A0A345SU70
LinkDB
Position
complement(1672831..1673664)
AA seq 277 aa
MPRSLSSGRGLRLSRLSRRADDRYLFIPLDHSVSDGPVVNADEFGALMGALVAGGADAVI
VHKGRARNIDPRHLRECALIIHLSAGTAHAADTNQKVLVGSVEDAVQLGADAVSVHVNVG
SETEAQQLADLGSVAAACTRWEMPLLAMIYPRGPRISNAHDPKLLAHVVNIAADLGADLI
KTSAAVPMSSMAAVVASCPVPVLVAGGPQNGQDLAGYAQSALDAGCSGLAVGRRVFTSPD
PEKLVRELVETVHAPHPHNPVGLPLSVSALYDTAATV
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcctcgatccctttccagtggaagggggcttcgtctcagccggctctcccgccgggcc
gacgatcgatacctcttcatcccgctggaccactccgtctccgacggcccggtcgtcaat
gccgatgaattcggcgccctcatgggggcgctggtcgccggcggcgccgacgcggtgatc
gtgcacaagggccgtgcccggaacatcgacccccggcatctgcgggagtgcgcgctgatc
atccatctcagcgcgggcaccgcccatgccgccgacaccaaccagaaggtgctggtcggc
agtgtcgaggacgccgtgcagctcggcgccgacgcggtcagcgtccacgtcaacgtgggc
tccgagacagaggcccagcagctcgccgacctcggcagcgtggccgccgcgtgcacgcgg
tgggagatgccgctgctcgcgatgatctatccgcgtggcccccggatcagcaatgcacac
gaccccaaactgctcgcccatgtggtgaacatcgccgccgacctcggcgccgacctcatc
aagacctcggcggccgtgccgatgagctcgatggccgcggtcgtggccagctgcccggtg
ccggtgctggtcgcgggcggtccgcagaacggccaggacctcgccgggtacgcgcagagc
gcgctcgacgccggttgcagcggcctcgccgtcggccgccgggtcttcaccagccccgac
cccgagaagctggtgcgggagctcgtcgagaccgtgcacgctcctcacccgcacaatccg
gtcgggcttccgctctccgtctccgcgctctatgacacggccgccacggtctga

DBGET integrated database retrieval system